format-version: 1.2 date: 02:01:2012 12:40 saved-by: ceci auto-generated-by: OBO-Edit 2.0 synonymtypedef: PSI-MOD-label "Unique short label curated by PSI-MOD" EXACT synonymtypedef: PRO-short-label "Unique short label for PRO terms for display purposes" EXACT default-namespace: protein idspace: PR http://purl.obolibrary.org/obo/PR_ idspace: CHEBI http://purl.obolibrary.org/obo/CHEBI_ idspace: GO http://purl.obolibrary.org/obo/GO_ idspace: MOD http://purl.obolibrary.org/obo/MOD_ idspace: NCBITaxon http://purl.obolibrary.org/obo/NCBITaxon_ idspace: OBI http://purl.obolibrary.org/obo/OBI_ idspace: SO http://purl.obolibrary.org/obo/SO_ data-version: 25.0. remark: This is a working version of the pro.obo file, so the content may change when released. Use reasoner in obo edit to see the correct hierarchy. ontology: pr [Term] id: CHEBI:16412 name: lipopolysaccharide namespace: CHEBI def: "Natural compounds consisting of a trisaccharide repeating unit (two heptose units and octulosonic acid) with oligosaccharide side chains and 3-hydroxytetradecanoic acid units (they are a major constituent of the cell walls of Gram-negative bacteria)." [fake:1] synonym: "LPS" RELATED [] is_a: CHEBI:23367 ! molecular entity [Term] id: CHEBI:23367 name: molecular entity namespace: CHEBI def: "Any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer etc., identifiable as a separately distinguishable entity." [fake:2] is_a: snap:Object ! object [Term] id: CHEBI:33708 name: amino-acid residue def: "When two or more amino acids combine to form a peptide, the elements of water are removed, and what remains of each amino acid is called an amino-acid residue." [Dummy:dummy] synonym: "amino acid residue" EXACT [] synonym: "protein residue" NARROW [PRO:DAN] is_a: snap:FiatObjectPart ! fiat_object_part relationship: part_of PR:000018263 ! amino acid chain [Term] id: CHEBI:4705 name: double-stranded DNA namespace: CHEBI synonym: "Double-stranded DNA" EXACT [KEGG COMPOUND:C00434] synonym: "C10H17O8PR2(C5H8O5PR)n.C10H17O7PR2(C5H8O6PR)n" RELATED [KEGG COMPOUND:C00434] xref: KEGG COMPOUND:C00434 "KEGG COMPOUND" is_a: CHEBI:23367 ! molecular entity [Term] id: CHEBI:16411 name: indole-3-acetic acid alt_id: CHEBI:24802 alt_id: CHEBI:5905 namespace: CHEBI def: "A member of the indole-3-acetic acids that has formula C10H9NO2." [] xref: ChemIDplus:87-51-4 "CAS Registry Number" xref: Gmelin:143197 "Gmelin Registry Number" xref: NIST Chemistry WebBook:87-51-4 "CAS Registry Number" xref: Beilstein:143358 "Beilstein Registry Number" xref: KEGG COMPOUND:C00954 "KEGG COMPOUND" xref: KEGG COMPOUND:87-51-4 "CAS Registry Number" is_a: CHEBI:23367 ! molecular entity [Term] id: CHEBI:18292 name: jasmonic acid alt_id: CHEBI:18487 alt_id: CHEBI:14486 alt_id: CHEBI:95 def: "An oxo monocarboxylic acid that has formula C12H18O3." [] namespace: CHEBI xref: LIPID MAPS:LMFA02020001 "LIPID MAPS instance" xref: ChemIDplus:6894-38-8 "CAS Registry Number" xref: KEGG COMPOUND:C08491 "KEGG COMPOUND" xref: KEGG COMPOUND:6894-38-8 "CAS Registry Number" is_a: CHEBI:23367 ! molecular entity [Term] id: GO:0000015 name: phosphopyruvate hydratase complex namespace: cellular_component def: "A multimeric enzyme complex, usually a dimer or an octamer, that catalyzes the conversion of 2-phospho-D-glycerate to phosphoenolpyruvate and water." [GOC:jl, ISBN:0198506732 "Oxford Dictionary of Biochemistry and Molecular Biology"] synonym: "enolase complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0000109 name: nucleotide-excision repair complex namespace: cellular_component def: "Any complex formed of proteins that act in nucleotide-excision repair." [PMID:10915862] comment: Note that process information is included in the term and definition for the purpose of describing and distinguishing the complex. is_a: GO:0043234 ! protein complex [Term] id: GO:0000127 name: transcription factor TFIIIC complex namespace: cellular_component def: "A transcription factor complex that is involved in regulating transcription from RNA polymerase III (Pol III) promoters. TFIIIC contains three conserved subunits that associate with the proximal Pol III promoter element, and additional subunits that associate with sequence elements downstream of the promoter and are more diverged among species." [GOC:mah, PMID:11433012] is_a: GO:0005667 ! transcription factor complex [Term] id: GO:0000307 name: cyclin-dependent protein kinase holoenzyme complex namespace: cellular_component def: "Cyclin-dependent protein kinases (CDKs) are heterodimeric enzymes that contain a kinase catalytic subunit associated with a regulatory cyclin partner." [GOC:krc, PMID:11602261] synonym: "CDK holoenzyme" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0000502 name: proteasome complex namespace: cellular_component def: "A large multisubunit complex which catalyzes protein degradation. This complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core." [GOC:rb] synonym: "26S proteasome" NARROW [] is_a: GO:0043234 ! protein complex [Term] id: GO:0000506 name: glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex namespace: cellular_component def: "An enzyme complex that catalyzes the transfer of GlcNAc from UDP-GlcNAc to an acceptor phosphatidylinositol, the first step in the production of GPI anchors for cell surface proteins. The complex contains PIG-A, PIG-C, PIG-H, PIG-Q, PIG-P, and DPM2 in human, and Eri1p, Gpi1p, Gpi2p, Gpi15p, Gpi19p, and Spt14p in budding yeast." [GOC:kp, GOC:rb, PMID:10944123, PMID:15163411] comment: Note that this term should not be confused with 'GPI-anchor transamidase complex ; GO:0042765', which represents a distinct complex with a different catalytic activity. synonym: "GPI-GlcNAc transferase complex" EXACT [] synonym: "GPI-GnT complex" EXACT [] synonym: "GPI-N-acetylglucosaminyltransferase complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0002169 name: 3-methylcrotonyl-CoA carboxylase complex, mitochondrial namespace: cellular_component def: "A heterodimeric complex having 3-methylcrotonyl-CoA carboxylase activity. The alpha subunit has a covalently bound biotin essential for the ATP-dependent carboxylation. The beta subunit possess carboxyltransferase activity which presumably is essential for binding to 3-methylcrotonyl-CoA." [GOC:hjd, PMID:15868465] is_a: GO:0043234 ! protein complex [Term] id: GO:0002178 name: palmitoyltransferase complex namespace: cellular_component def: "A protein complex with palmitoyltransferase activity." [GOC:hjd] is_a: GO:0043234 ! protein complex [Term] id: GO:0002179 name: homodimeric serine palmitoyltransferase complex namespace: cellular_component def: "A homodimeric complex which transfers palmitoylate onto serine, forming 3-dehydro-D-sphinganine." [GOC:hjd] comment: This complex occurs primarily in bacteria. is_a: GO:0002178 ! palmitoyltransferase complex [Term] id: GO:0002180 name: 5-lipoxygenase complex namespace: cellular_component def: "An nuclear membrane protein complex having arachidonate 5-lipoxygenase activity." [PMID:19075240] is_a: GO:0043234 ! protein complex [Term] id: GO:0002185 name: creatine kinase complex namespace: cellular_component def: "A protein complex having creatine kinase activity." [GOC:hjd] is_a: GO:0043234 ! protein complex [Term] id: GO:0002186 name: cytosolic creatine kinase complex namespace: cellular_component def: "A dimeric protein complex having creatine kinase activity." [PMID:173175] is_a: GO:0002185 ! creatine kinase complex [Term] id: GO:0002197 name: xanthine dehydrogenase complex namespace: cellular_component def: "A homodimeric protein complex having xanthine dehydrogenase activity." [GOC:hjd, PMID:8224915] is_a: GO:0043234 ! protein complex [Term] id: GO:0002199 name: sperm protein complex namespace: cellular_component def: "A multisubunit complex comprising the chaperonin-containing T-complex and several other components involved in mediating sperm-oocyte Interaction." [GOC:hjd, PMID:21880732] is_a: GO:0043234 ! protein complex [Term] id: GO:0005610 name: laminin-5 complex namespace: cellular_component def: "A laminin complex composed of alpha3, beta3 and gamma2 polypeptide chains." [GOC:jl, PMID:10842354] is_a: GO:0043256 ! laminin complex [Term] id: GO:0005658 name: alpha DNA polymerase:primase complex namespace: cellular_component def: "A complex of four polypeptides, comprising large and small DNA polymerase alpha subunits and two primase subunits, which catalyzes the synthesis of an RNA primer on the lagging strand of replicating DNA; the smaller of the two primase subunits alone can catalyze oligoribonucleotide synthesis." [GOC:mah, PMID:11395402] synonym: "DNA polymerase alpha:primase complex" EXACT [] synonym: "heterotetrameric polymerase alpha holoenzyme" EXACT [] synonym: "pol-prim" RELATED [] synonym: "primosome" BROAD [] is_a: GO:0043234 ! protein complex [Term] id: GO:0005662 name: DNA replication factor A complex namespace: cellular_component def: "A conserved heterotrimeric complex that binds nonspecifically to single-stranded DNA and is required for multiple processes in eukaryotic DNA metabolism, including DNA replication, DNA repair, and recombination. In all eukaryotic organisms examined the complex is composed of subunits of approximately 70, 30, and 14 kDa." [PMID:9242902] synonym: "replication protein A" EXACT [] synonym: "RPA" EXACT [] synonym: "single-stranded DNA-binding protein complex" RELATED [] synonym: "SSB" RELATED [] xref: Wikipedia:Replication_protein_A is_a: GO:0043234 ! protein complex [Term] id: GO:0005663 name: DNA replication factor C complex namespace: cellular_component def: "A complex of five polypeptides in eukaryotes, and two in prokaryotes, that loads the DNA polymerase processivity factor proliferating cell nuclear antigen (PCNA) onto DNA, thereby permitting processive DNA synthesis catalyzed by DNA polymerase." [PMID:14614842, PMID:14646196, PMID:16172520] synonym: "activator 1 complex" EXACT [] synonym: "RFC complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0005667 name: transcription factor complex namespace: cellular_component def: "A protein complex, distinct from RNA polymerase, that associates with DNA at promoters or at cis-acting regulatory sequences, by direct binding or by interaction with other DNA-binding polypeptides or complexes, and regulates transcription." [GOC:mah] is_a: GO:0043234 ! protein complex [Term] id: GO:0005669 name: transcription factor TFIID complex namespace: cellular_component def: "A complex composed of TATA binding protein (TBP) and TBP associated factors (TAFs); the total mass is typically about 800 kDa. Most of the TAFs are conserved across species. In TATA-containing promoters for RNA polymerase II (Pol II), TFIID is believed to recognize at least two distinct elements, the TATA element and a downstream promoter element. TFIID is also involved in recognition of TATA-less Pol II promoters. Binding of TFIID to DNA is necessary but not sufficient for transcription initiation from most RNA polymerase II promoters." [GOC:krc, GOC:mah, ISBN:0471953393, ISBN:0879695501] is_a: GO:0005667 ! transcription factor complex [Term] id: GO:0005674 name: transcription factor TFIIF complex namespace: cellular_component def: "A general transcription initiation factor which in humans consists of a heterodimer of an alpha and a beta subunit. Helps recruit RNA polymerase II to the initiation complex and promotes translation elongation." [GOC:jl, PMID:7597077] is_a: GO:0005667 ! transcription factor complex [Term] id: GO:0005680 name: anaphase-promoting complex namespace: cellular_component def: "A ubiquitin ligase complex that degrades mitotic cyclins and anaphase inhibitory protein, thereby triggering sister chromatid separation and exit from mitosis. Substrate recognition by APC occurs through degradation signals, the most common of which is termed the Dbox degradation motif, originally discovered in cyclin B." [GOC:jh, PMID:10465783, PMID:10611969] comment: Note that the synonym 'APC' should not be confused with the abbreviation for the adenomatous polyposis coli gene and protein. synonym: "anaphase promoting complex" EXACT [] synonym: "cyclosome" EXACT [] synonym: "APC" BROAD [] xref: Wikipedia:Anaphase-promoting_complex is_a: GO:0043234 ! protein complex [Term] id: GO:0005832 name: chaperonin-containing T-complex namespace: cellular_component def: "A multisubunit ring-shaped complex that mediates protein folding in the cytosol without a cofactor." [GOC:sgd_curators, PMID:11580267] synonym: "CCT particle" EXACT [] synonym: "TriC" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0008024 name: positive transcription elongation factor complex b namespace: cellular_component def: "A transcription elongation factor complex that facilitates the transition from abortive to productive elongation by phosphorylating the CTD domain of the large subunit of DNA-directed RNA polymerase II, holoenzyme. Contains cyclin T and a cyclin-dependent protein kinase catalytic subunit." [PMID:10766736, PMID:16721054, PMID:17079683, PMID:19328067, PMID:7759473] comment: See also the cellular component terms 'cyclin-dependent protein kinase activating kinase holoenzyme complex ; GO:0019907' and 'DNA-directed RNA polymerase II, holoenzyme ; GO:0016591'. synonym: "P-TEFb" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0070691 name: dimeric positive transcription elongation factor complex b namespace: cellular_component def: "A positive transcription elongation factor complex b that comprises two subunits; an example is the budding yeast complex containing Svg1p (also called Bur1p) and Bur2p." [GOC:mah, PMID:16721054, PMID:19328067] synonym: "Bur1/Bur2 complex" NARROW [] synonym: "Sgv1/Bur2 complex" NARROW [] is_a: GO:0008024 ! positive transcription elongation factor complex b [Term] id: GO:0005736 name: DNA-directed RNA polymerase I complex namespace: cellular_component def: "RNA polymerase I, one of three nuclear DNA-directed RNA polymerases found in all eukaryotes, is a multisubunit complex; typically it produces rRNAs. Two large subunits comprise the most conserved portion including the catalytic site and share similarity with other eukaryotic and bacterial multisubunit RNA polymerases. The remainder of the complex is composed of smaller subunits (generally ten or more), some of which are also found in RNA polymerase III and others of which are also found in RNA polymerases II and III. Although the core is competent to mediate ribonucleic acid synthesis, it requires additional factors to select the appropriate template." [GOC:krc, GOC:mtg_sensu] synonym: "DNA-directed RNA polymerase I activity" RELATED [] is_a: GO:0043234 ! protein complex [Term] id: GO:0005751 name: mitochondrial respiratory chain complex IV namespace: cellular_component alt_id: GO:0005752 def: "A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2)." [GOC:mtg_sensu, ISBN:0198547684] is_a: GO:0045277 ! respiratory chain complex IV [Term] id: GO:0005787 name: signal peptidase complex namespace: cellular_component def: "A protein complex that is located in the endoplasmic reticulum membrane and cleaves the signal sequence from precursor proteins following their transport out of the cytoplasmic space." [GOC:sgd_curators, PMID:1846444, PMID:7615509] is_a: GO:0043234 ! protein complex [Term] id: GO:0005834 name: heterotrimeric G-protein complex namespace: cellular_component def: "Any of a family of heterotrimeric GTP-binding and hydrolyzing proteins; they belong to a superfamily of GTPases that includes monomeric proteins such as EF-Tu and RAS. Heterotrimeric G-proteins consist of three subunits; the alpha subunit contains the guanine nucleotide binding site and possesses GTPase activity; the beta and gamma subunits are tightly associated and function as a beta-gamma heterodimer; extrinsic plasma membrane proteins (cytoplasmic face) that function as a complex to transduce signals from G-protein coupled receptors to an effector protein." [ISBN:0198547684] comment: See also the molecular function term 'G-protein coupled receptor activity ; GO:0004930'. synonym: "heterotrimeric G-protein GTPase activity" RELATED [] synonym: "heterotrimeric G-protein GTPase, alpha-subunit" NARROW [] synonym: "heterotrimeric G-protein GTPase, beta-subunit" NARROW [] synonym: "heterotrimeric G-protein GTPase, gamma-subunit" NARROW [] is_a: GO:0043234 ! protein complex [Term] id: GO:0005845 name: mRNA cap binding complex namespace: cellular_component def: "Any protein complex that binds to an mRNA cap at any time in the lifetime of the mRNA." [GOC:jic] synonym: "mRNA cap complex" RELATED [] is_a: GO:0043234 ! protein complex [Term] id: GO:0005848 name: mRNA cleavage stimulating factor complex namespace: cellular_component def: "A protein complex required for mRNA cleavage but not for poly(A) addition." [GOC:mah, PMID:10357856] synonym: "cleavage stimulation factor activity" RELATED [] synonym: "CstF complex" NARROW [] is_a: GO:0043234 ! protein complex [Term] id: GO:0005850 name: eukaryotic translation initiation factor 2 complex namespace: cellular_component def: "Complex of three heterogeneous polypeptide chains, that form a ternary complex with initiator methionyl-tRNA and GTP. This ternary complex binds to free 40S subunit, which subsequently binds the 5' end of mRNA." [PMID:10216940] synonym: "eIF-2" EXACT [] synonym: "eIF2" EXACT [] xref: Wikipedia:EIF-2 is_a: GO:0043234 ! protein complex [Term] id: GO:0005871 name: kinesin complex namespace: cellular_component def: "Any complex that includes a dimer of molecules from the kinesin superfamily, a group of related proteins that contain an extended region of predicted alpha-helical coiled coil in the main chain that likely produces dimerization. The native complexes of several kinesin family members have also been shown to contain additional peptides, often designated light chains as all of the noncatalytic subunits that are currently known are smaller than the chain that contains the motor unit. Kinesin complexes generally possess a force-generating enzymatic activity, or motor, which converts the free energy of the gamma phosphate bond of ATP into mechanical work." [GOC:mah, http://www.proweb.org/kinesin//KinesinMotility.html, http://www.proweb.org/kinesin//KinesinStructure.html] is_a: GO:0043234 ! protein complex [Term] id: GO:0005872 name: minus-end kinesin complex namespace: cellular_component def: "Any complex that includes a dimer of molecules from the kinesin superfamily and any associated proteins, and moves towards the minus end of a microtubule." [GOC:mah] is_a: GO:0005871 ! kinesin complex [Term] id: GO:0005873 name: plus-end kinesin complex namespace: cellular_component def: "Any complex that includes a dimer of molecules from the kinesin superfamily and any associated proteins, and moves towards the plus end of a microtubule." [GOC:mah] is_a: GO:0005871 ! kinesin complex [Term] id: GO:0005892 name: nicotinic acetylcholine-gated receptor-channel complex namespace: cellular_component def: "A protein complex that acts as an acetylcholine receptor, and forms a transmembrane channel through which ions may pass in response to ligand binding. The complex is a homo- or heteropentamer of subunits that are members of a neurotransmitter receptor superfamily." [GOC:mah, PMID:12381728, PMID:15579462] synonym: "nicotinic acetylcholine receptor" BROAD [] is_a: GO:0034702 ! ion channel complex is_a: GO:0043235 ! receptor complex [Term] id: GO:0005922 name: connexon complex namespace: cellular_component def: "An assembly of six molecules of connexin, made in the Golgi apparatus and subsequently transported to the plasma membrane, where docking of two connexons on apposed plasma membranes across the extracellular space forms a gap junction." [PMID:11146276] xref: NIF_Subcellular:sao445019788 is_a: GO:0043234 ! protein complex [Term] id: GO:0005942 name: phosphatidylinositol 3-kinase complex namespace: cellular_component def: "A complex containing a heterodimer of a catalytic subunit and a regulatory (adaptor) subunit of any phosphatidylinositol 3-kinase (PI3K)." [GOC:bf] synonym: "1-phosphatidylinositol 3-kinase complex" EXACT [] synonym: "phosphoinositide 3-kinase complex" EXACT [GOC:curators] synonym: "PI3K complex" EXACT [] synonym: "PI3-kinase p85-subunit alpha- PI3-kinase p110 complex" NARROW [CORUM:2575] synonym: "PIK3C3-PIK3R4 complex" NARROW [CORUM:429] synonym: "PIK3CA-PIK3R1 complex" NARROW [CORUM:439] is_a: GO:0043234 ! protein complex [Term] id: GO:0005945 name: 6-phosphofructokinase complex namespace: cellular_component def: "A protein complex that possesses 6-phosphofructokinase activity; homodimeric, homooctameric, and allosteric homotetrameric forms are known." [GOC:mah, GOC:vw, ISBN:0198506732 "Oxford Dictionary of Biochemistry and Molecular Biology"] is_a: GO:0043234 ! protein complex [Term] id: GO:0005953 name: CAAX-protein geranylgeranyltransferase complex namespace: cellular_component def: "A heterodimeric enzyme, composed of an alpha and a beta subunit. Participates in the post-translational C-terminal modification of several small GTPases, allowing their targeting to the membrane." [PMID:9781874] is_a: GO:0043234 ! protein complex [Term] id: GO:0005956 name: protein kinase CK2 complex namespace: cellular_component def: "A protein complex that possesses protein serine/threonine kinase activity, and contains two catalytic alpha subunits and two regulatory beta subunits. Protein kinase CK2 complexes are found in nearly every subcellular compartment, and can phosphorylate many protein substrates in addition to casein." [GOC:mah, PMID:10994779] comment: Note that this term represents a location and not a function; the activity possessed by this complex is mentioned in the definition for the purpose of describing and distinguishing the complex. synonym: "casein kinase II complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0005962 name: mitochondrial isocitrate dehydrogenase complex (NAD+) namespace: cellular_component def: "Mitochondrial complex that possesses isocitrate dehydrogenase (NAD+) activity." [GOC:mah, GOC:mtg_sensu] comment: Note that this term represents a location and not a function; the activity possessed by this complex is mentioned in the definition for the purpose of describing and distinguishing the complex. The function of this complex is represented by the molecular function term 'isocitrate dehydrogenase (NAD+) activity ; GO:0004449'. is_a: GO:0043234 ! protein complex [Term] id: GO:0005964 name: phosphorylase kinase complex namespace: cellular_component def: "An enzyme complex that catalyzes the phosphorylation of phosphorylase b to form phosphorylase a." [EC:2.7.11.19] is_a: GO:0043234 ! protein complex [Term] id: GO:0005965 name: protein farnesyltransferase complex namespace: cellular_component def: "A protein complex that possesses protein farnesyltransferase activity." [GOC:mah] is_a: GO:0043234 ! protein complex [Term] id: GO:0005971 name: ribonucleoside-diphosphate reductase complex namespace: cellular_component def: "An enzyme complex composed of 2-4 or more subunits, which usually contains nonheme iron and requires ATP for catalysis. Catalyzes the formation of 2'-deoxyribonucleoside diphosphate and thioredoxin disulfide from ribonucleoside diphosphate and thioredoxin." [BRENDA:1.17.4.1] is_a: GO:0043234 ! protein complex [Term] id: GO:0008278 name: cohesin complex namespace: cellular_component alt_id: GO:0008279 alt_id: GO:0043222 def: "A protein complex that is required for sister chromatid cohesion in eukaryotes. The cohesin complex forms a molecular ring complex, and is composed of structural maintenance of chromosomes (SMC) and kleisin proteins. For example, in yeast, the complex is composed of the SMC proteins Smc1p and Smc3p, and the kleisin protein Scc1p. In vertebrates, the complex is composed of the SMC1 (SMC1A or SMC1B) and SMC3 heterodimer attached via their hinge domains to a kleisin (RAD21, REC8 or RAD21L) which links them, and one STAG protein (STAG1, STAG2 or STAG3)." [GOC:sp, PMID:9887095] synonym: "SMC/kleisin ring complex" EXACT [] synonym: "SMC complex" RELATED [] synonym: "14S cohesin" NARROW [] is_a: GO:0043234 ! protein complex [Term] id: GO:0008303 name: caspase complex namespace: cellular_component def: "A protein complex that is located in the cytosol and acts as a cysteine-type endopeptidase are involved in apoptosis; the peptidase activity has specificity for the hydrolysis of aspartyl bonds." [GOC:mah, ISBN:0198506732] is_a: GO:0043234 ! protein complex [Term] id: GO:0008305 name: integrin complex namespace: cellular_component def: "A protein complex that is composed of one alpha subunit and one beta subunit, both of which are members of the integrin superfamily of cell adhesion receptors; the complex spans the plasma membrane and binds to extracellular matrix ligands, cell-surface ligands, and soluble ligands." [PMID:17543136] synonym: "laminin receptor protein" RELATED [] is_a: GO:0043235 ! receptor complex [Term] id: GO:0008385 name: IkappaB kinase complex namespace: cellular_component def: "A protein serine/threonine kinase that phosphorylates IkappaB, thereby targeting this for proteasomal degradation and allowing the nuclear translocation of kB. Composed of alpha, beta and gamma subunits, the latter not having kinase activity but presumed to play a regulatory role." [GOC:ma] synonym: "IKK complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0009348 name: ornithine carbamoyltransferase complex namespace: cellular_component def: "A homotrimeric protein complex that catalyzes the transfer of a carbamoyl group to ornithine, forming citrulline." [EC:2.1.3.3, GOC:mah] is_a: GO:0043234 ! protein complex [Term] id: GO:0016272 name: prefoldin complex namespace: cellular_component def: "A multisubunit chaperone that acts to delivers unfolded proteins to cytosolic chaperonin. In humans, the complex is a heterohexamer of two PFD-alpha and four PFD-beta type subunits." [GOC:jl, PMID:17384227, PMID:9630229] synonym: "GIM complex" NARROW [] xref: Wikipedia:Prefoldin is_a: GO:0043234 ! protein complex [Term] id: GO:0016507 name: fatty acid beta-oxidation multienzyme complex namespace: cellular_component def: "A complex that includes the long-chain 3-hydroxyacyl-CoA dehydrogenase and long-chain enoyl-CoA hydratase activities in two subunits (alpha and beta), catalyzing two steps of the fatty acid beta-oxidation cycle within the mitochondrial matrix." [GOC:ma] synonym: "trifunctional enzyme" RELATED [] is_a: GO:0043234 ! protein complex [Term] id: GO:0016533 name: cyclin-dependent protein kinase 5 holoenzyme complex namespace: cellular_component def: "A protein complex that activates cyclin-dependent kinase 5; composed of regulatory and catalytic subunits." [PMID:15689152] is_a: GO:0000307 ! cyclin-dependent protein kinase holoenzyme complex [Term] id: GO:0017059 name: serine C-palmitoyltransferase complex namespace: cellular_component def: "An enzyme complex that catalyzes the transfer of a palmitoyl on to serine, forming 3-dehydro-D-sphinganine." [EC:2.3.1.50] is_a: GO:0031211 ! endoplasmic reticulum palmitoyltransferase complex [Term] id: GO:0017101 name: aminoacyl-tRNA synthetase multienzyme complex namespace: cellular_component def: "A multienzyme complex found in all multicellular eukaryotes composed of eight proteins with aminoacyl-tRNA synthetase activities (abbreviated as: ArgRS, AspRS, GluProRS, GlnRS, IleRS, LeuRS, LysRS, MetRS where RS is the enzyme, preceded by the amino acid it uses as a substrate) as well as three non-synthetase proteins (p43, p38, and p18) with diverse functions. Several of these subunits are known dimers, so the total polypeptide count in the multisynthetase complex is at least fifteen. All of the enzymes in this assembly catalyze the same reaction, the covalent attachment of an amino acid to either the 2'- or 3'-hydroxyl of the 3'-terminal adenosine of tRNA, but using different substrates." [GOC:jl, PMID:16169847] synonym: "aminoacyl-tRNA synthetase complex" EXACT [] synonym: "multisynthetase complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0017109 name: glutamate-cysteine ligase complex namespace: cellular_component def: "An enzyme complex that catalyzes the ligation of glutamate to cysteine, forming glutamylcysteine." [EC:6.3.2.2] synonym: "gamma-glutamylcysteine synthetase complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0019005 name: SCF ubiquitin ligase complex namespace: cellular_component def: "A ubiquitin ligase complex in which a cullin from the Cul1 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 adaptor and an F-box protein. SCF complexes are involved in targeting proteins for degradation by the proteasome. The best characterized complexes are those from yeast and mammals (with core subunits named Cdc53/Cul1, Rbx1/Hrt1/Roc1)." [PMID:15571813, PMID:15688063] synonym: "CDL1 complex" EXACT [] synonym: "CRL1 complex" EXACT [] synonym: "Cul1-RING ubiquitin ligase complex" EXACT [] synonym: "cullin-RING ligase 1" EXACT [] synonym: "SCF complex" EXACT [] synonym: "Skp1/Cul1/F-box protein complex" EXACT [] synonym: "SCF complex substrate recognition subunit" NARROW [] xref: Wikipedia:SCF_complex is_a: GO:0031461 ! cullin-RING ubiquitin ligase complex [Term] id: GO:0019185 name: snRNA-activating protein complex namespace: cellular_component def: "A protein complex that recognizes the proximal sequence element of RNA polymerase II and III snRNA promoters." [PMID:7715707, PMID:9003788] synonym: "SNAPc" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0019907 name: cyclin-dependent protein kinase activating kinase holoenzyme complex namespace: cellular_component def: "A protein complex that phosphorylates cyclin-dependent kinases such as Cdc2 on Thr161 (or an equivalent residue); contains a catalytic subunit and a regulatory subunit, and some examples also include an assembly factor." [GOC:mah, PMID:8752210] synonym: "CAK complex" EXACT [] synonym: "CDK-activating kinase complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0030126 name: COPI vesicle coat namespace: cellular_component alt_id: GO:0017167 def: "One of two multimeric complexes that forms a membrane vesicle coat. The mammalian COPI subunits are called alpha-, beta-, beta'-, gamma-, delta-, epsilon- and zeta-COP. Vesicles with COPI coats are found associated with Golgi membranes at steady state." [GOC:mah, PMID:11252894] synonym: "coatomer" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0031211 name: endoplasmic reticulum palmitoyltransferase complex namespace: cellular_component def: "A dimeric complex of the endoplasmic reticulum that catalyzes S-palmitoylation, the addition of palmitate (C16:0) or other long-chain fatty acids to proteins at a cysteine residue." [GOC:jh] is_a: GO:0002178 ! palmitoyltransferase complex [Term] id: GO:0031264 name: death-inducing signaling complex namespace: cellular_component def: "A protein complex formed by the association of signaling proteins with a death receptor upon ligand binding. The complex includes procaspases and death domain-containing proteins in addition to the ligand-bound receptor." [PMID:12628743, PMID:12655293] synonym: "death-inducing signalling complex" EXACT [] synonym: "DISC" EXACT [] xref: Wikipedia:Death-inducing_signaling_complex is_a: GO:0043234 ! protein complex [Term] id: GO:0031461 name: cullin-RING ubiquitin ligase complex namespace: cellular_component def: "Any ubiquitin ligase complex in which the catalytic core consists of a member of the cullin family and a RING domain protein; the core is associated with one or more additional proteins that confer substrate specificity." [PMID:15571813, PMID:15688063] synonym: "CRL complex" EXACT [] synonym: "cullin complex" EXACT [] synonym: "cullin-RING ligase" RELATED [] is_a: GO:0043234 ! protein complex [Term] id: GO:0031501 name: mannosyltransferase complex namespace: cellular_component def: "A complex that posseses mannosyltransferase activity." [GOC:mah] is_a: GO:0043234 ! protein complex [Term] id: GO:0032144 name: 4-aminobutyrate transaminase complex namespace: cellular_component def: "A homodimeric protein complex that possesses 4-aminobutyrate transaminase activity." [GOC:mah, PMID:15528998] synonym: "ABAT complex" EXACT [] synonym: "GABA transaminase complex" EXACT [] synonym: "GABA-T complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0032299 name: ribonuclease H2 complex namespace: cellular_component def: "A protein complex that possesses ribonuclease H activity, in which the catalytic subunit is a member of the RNase H2 (or HII) class. For example, in Saccharomyces the complex contains Rnh201p, Rnh202p and Rnh203p." [GOC:mah, PMID:14734815] synonym: "RNase H2 complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0032991 name: macromolecular complex namespace: cellular_component def: "A stable assembly of two or more macromolecules, i.e. proteins, nucleic acids, carbohydrates or lipids, in which the constituent parts function together." [GOC:mah] is_a: snap:Object ! object [Term] id: GO:0032996 name: Bcl3-Bcl10 complex namespace: cellular_component def: "A protein complex containing Bcl3 and Bcl10, which forms when Akt1 is activated by TNF-alpha to phosphorylate Bcl10; the Bcl3-Bcl10 complex is translocated to the nucleus." [PMID:16280327] is_a: GO:0043234 ! protein complex [Term] id: GO:0033185 name: dolichol-phosphate-mannose synthase complex namespace: cellular_component def: "A protein complex that possesses dolichyl-phosphate beta-D-mannosyltransferase activity; contains a catalytic subunit, a regulatory subunit, and a third subunit that stabilizes the complex. In human and several other metazoa, the subunits are named DPM1, DPM2 and DPM3, respectively." [PMID:10835346] synonym: "dolichyl-phosphate beta-D-mannosyltransferase complex" EXACT [] synonym: "DPM synthase complex" EXACT [] is_a: GO:0031501 ! mannosyltransferase complex [Term] id: GO:0034688 name: alphaM-beta2 integrin complex namespace: cellular_component def: "An integrin complex that comprises one alphaM subunit and one beta2 subunit." [PMID:12297042] synonym: "Itgam-Itgb2 complex" NARROW [] is_a: GO:0008305 ! integrin complex [Term] id: GO:0034702 name: ion channel complex namespace: cellular_component def: "A protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient." [GOC:mah, ISBN:071673706X] is_a: GO:0043234 ! protein complex [Term] id: GO:0035354 name: Toll-like receptor 1-Toll-like receptor 2 protein complex namespace: cellular_component def: "A heterodimeric protein complex containing Toll-like receptor 1 (TLR1) and Toll-like receptor 2 (TLR2)." [GOC:add, PMID:17889651] synonym: "TLR1-TLR2 protein complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0035355 name: Toll-like receptor 2-Toll-like receptor 6 protein complex namespace: cellular_component def: "A heterodimeric protein complex containing Toll-like receptor 2 (TLR2) and Toll-like receptor 6 (TLR6)." [GOC:add, PMID:19931471] synonym: "TLR2-TLR6 protein complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0071159 name: NF-kappaB complex namespace: cellular_component def: "A protein complex that consists of a homo- or heterodimer of members of a family of structurally related proteins that contain a conserved N-terminal region called the Rel homology domain (RHD). In the nucleus, NF-kappaB complexes act as transcription factors. In unstimulated cells, NF-kappaB dimers are sequestered in the cytoplasm by IkappaB monomers; signals that induce NF-kappaB activity cause degradation of IkappaB, allowing NF-kappaB dimers to translocate to the nucleus and induce gene expression." [ISBN:0849327946] is_a: GO:0043234 ! protein complex [Term] id: GO:0035525 name: NF-kappaB p50/p65 complex namespace: cellular_component def: "A heterodimer of NF-kappa B p50 and p65 subunits." [GO:add, PMID:20393192, PMID:9299584] comment: Note that the p50 subunit is encoded by NFKB1 gene in human and the p65 subunit is encoded by the RELA gene in human. Similar nomenclature is used in other vertebrate species. The p50 subunit has a precursor form p105 in some publications. synonym: "NF-kappa p105/p65 complex" RELATED [] synonym: "NF-kappa p105/RelA complex" RELATED [] synonym: "NF-kappa B1/p65 complex" EXACT [] synonym: "NF-kappa B1/RelA complex" EXACT [] synonym: "NF-kappa p50/RelA complex" EXACT [] is_a: GO:0071159 ! NF-kappaB complex [Term] id: GO:0042555 name: MCM complex namespace: cellular_component def: "A hexameric protein complex required for the initiation and regulation of DNA replication." [GOC:jl, PMID:11282021] synonym: "mini-chromosome maintenance complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0042709 name: succinate-CoA ligase complex namespace: cellular_component def: "A heterodimeric enzyme complex, usually composed of an alpha and beta chain. Functions in the TCA cycle, hydrolyzing succinyl-CoA into succinate and CoA, thereby forming ATP or GTP." [EC:6.2.1.4, EC:6.2.1.5, GOC:jl] is_a: GO:0043234 ! protein complex [Term] id: GO:0042765 name: GPI-anchor transamidase complex namespace: cellular_component def: "An enzyme complex which in humans and yeast consists of at least five proteins; for example, the complex contains GAA1, GPI8, PIG-S, PIG-U, and PIG-T in human, and Gaa1p, Gab1p, Gpi8p, Gpi16p, and Gpi17p in yeast. Catalyzes the posttranslational attachment of the carboxyl-terminus of a precursor protein to a GPI-anchor." [GOC:jl, GOC:rb, PMID:12802054] comment: Note that this term should not be confused with 'glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex ; GO:0000506', which represents a distinct complex with a different catalytic activity. synonym: "GPIT complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0043234 name: protein complex namespace: cellular_component def: "Any macromolecular complex composed of two or more polypeptide subunits, which may or may not be identical. Protein complexes may have other associated non-protein prosthetic groups, such as nucleotides, metal ions or carbohydrate groups." [GOC:go_curators] comment: Note that although at some level almost all cellular components can be thought of as protein complexes, this term is intended to exclude structures composed of the same repeating subunit or subunits, for example microtubules. Protein complexes encompassed by this term are generally not structural, and usually have a defined set of subunits. synonym: "protein-protein complex" EXACT [] is_a: GO:0032991 ! macromolecular complex [Term] id: GO:0043235 name: receptor complex namespace: cellular_component def: "Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function." [GOC:go_curators] is_a: GO:0043234 ! protein complex [Term] id: GO:0043240 name: Fanconi anaemia nuclear complex namespace: cellular_component def: "A protein complex composed of the Fanconi anaemia (FA) proteins including A, C, E, G and F (FANCA-F). Functions in the activation of the downstream protein FANCD2 by monoubiquitylation, and is essential for protection against chromosome breakage." [GOC:jl, PMID:12093742] synonym: "FA complex" EXACT [] synonym: "FA core complex" EXACT [] synonym: "FA nuclear complex" EXACT [] synonym: "Fanconi anaemia complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0043256 name: laminin complex namespace: cellular_component def: "A large, extracellular glycoprotein complex composed of three different polypeptide chains, alpha, beta and gamma. Provides an integral part of the structural scaffolding of basement membranes." [GOC:jl, http://www.sdbonline.org/fly/newgene/laminna1.htm, PMID:10842354] is_a: GO:0043234 ! protein complex [Term] id: GO:0043540 name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 complex namespace: cellular_component def: "A homodimeric, bifunctional enzyme complex which catalyzes the synthesis and degradation of fructose 2,6-bisphosphate, and is required for both glycolysis and gluconeogenesis." [GOC:jl, GOC:so] is_a: GO:0043234 ! protein complex [Term] id: GO:0043626 name: PCNA complex namespace: cellular_component def: "A protein complex composed of three identical PCNA monomers, each comprising two similar domains, which are joined in a head-to-tail arrangement to form a homotrimer. Forms a ring-like structure in solution, with a central hole sufficiently large to accommodate the double helix of DNA. Originally characterized as a DNA sliding clamp for replicative DNA polymerases and as an essential component of the replisome, and has also been shown to be involved in other processes including Okazaki fragment processing, DNA repair, translesion DNA synthesis, DNA methylation, chromatin remodeling and cell cycle regulation." [GOC:jl, PMID:12829735] synonym: "PCNA homotrimer" EXACT [] synonym: "proliferating cell nuclear antigen complex" EXACT [] synonym: "sliding clamp" BROAD [] is_a: GO:0043234 ! protein complex [Term] id: GO:0045244 name: succinate-CoA ligase complex (GDP-forming) namespace: cellular_component alt_id: GO:0008325 alt_id: GO:0045245 def: "A heterodimeric enzyme complex, usually composed of an alpha and beta chain. Functions in the TCA cycle, hydrolyzing succinyl-CoA into succinate and CoA, thereby forming GTP." [EC:6.2.1.4, GOC:jl] synonym: "succinyl-CoA synthetase, GDP-forming" EXACT [CORUM:392] is_a: GO:0042709 ! succinate-CoA ligase complex [Term] id: GO:0045277 name: respiratory chain complex IV namespace: cellular_component alt_id: GO:0045287 def: "A part of the respiratory chain, containing the 13 polypeptide subunits of cytochrome c oxidase, including cytochrome a and cytochrome a3. Catalyzes the oxidation of reduced cytochrome c by dioxygen (O2)." [ISBN:0198547684] synonym: "cytochrome c oxidase complex" EXACT [] synonym: "electron transport complex IV" RELATED [] is_a: GO:0043234 ! protein complex [Term] id: GO:0046696 name: lipopolysaccharide receptor complex namespace: cellular_component def: "A multiprotein complex that consists of at least three proteins, CD14, TLR4, and MD-2, each of which is glycosylated." [PMID:11706042] comment: Note that this term should not be used to refer to CD14 alone, but the multiprotein receptor complex that it is part of. synonym: "LPS receptor complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0070018 name: transforming growth factor beta type I receptor complex namespace: cellular_component def: "A receptor complex that consists of two transforming growth factor beta (TGF-beta) type I receptor monomers. TGF-beta type I receptor dimers form in the presence or absence of ligand, and can associate with ligand-bound TGF-beta type II receptor dimers." [Reactome:REACT_7737] synonym: "TGF-beta type I receptor complex" EXACT [] synonym: "TGF-beta type I receptor dimer" EXACT [] is_a: GO:0070022 ! transforming growth factor beta receptor complex [Term] id: GO:0070019 name: transforming growth factor beta type II receptor complex namespace: cellular_component def: "A receptor complex that consists of two transforming growth factor beta (TGF-beta) type II receptor monomers. TGF-beta type II receptor dimers form in the presence or absence of ligand, and upon ligand binding can associate with TGF-beta type I receptor dimers." [Reactome:REACT_7415] synonym: "TGF-beta type II receptor complex" EXACT [] synonym: "TGF-beta type II receptor dimer" EXACT [] is_a: GO:0070022 ! transforming growth factor beta receptor complex [Term] id: GO:0070022 name: transforming growth factor beta receptor complex namespace: cellular_component def: "A dimeric receptor complex that binds transforming growth factor beta (TGF-beta); consists of two TGF-beta receptor monomers." [GOC:mah, Reactome:REACT_7415, Reactome:REACT_7737] synonym: "TGF-beta receptor complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0070187 name: telosome namespace: cellular_component def: "A nuclear telomere cap complex that is formed by the association of telomeric ssDNA- and dsDNA-binding proteins with telomeric DNA, and is involved in telomere protection and recruitment of telomerase. The complex contains TRF1, TRF2, POT1, RAP1, TIN2 and TPP1 in mammalian cells, and Pot1, Tpz1, Ccq1, Poz1, and Rap1 in Schizosaccharomyces. Taz1 and Rap1 (or their mammalian equivalents) form a dsDNA-binding subcomplex, Pot1 and Tpz1 form an ssDNA-binding subcomplex, and the two subcomplexes are bridged by Poz1." [GOC:expert_mf, GOC:mah, GOC:vw, PMID:18828880] synonym: "Pot1 complex" EXACT [GOC:vw] synonym: "Pot1-Tpz1 complex" EXACT [GOC:vw] synonym: "shelterin complex" EXACT [GOC:mah, GOC:vw] is_a: GO:0043234 ! protein complex [Term] id: GO:0070439 name: mad-max-mSin3A complex namespace: cellular_component def: "A transcriptional repressor complex that contains a heterodimer of the bHLH-ZIP proteins Mad and Max, plus mSin3A, a homolog of the yeast Sin3p." [PMID:7889570] is_a: GO:0043234 ! protein complex [Term] id: GO:0070440 name: mad-max-mSin3B complex namespace: cellular_component def: "A transcriptional repressor complex that contains a heterodimer of the bHLH-ZIP proteins Mad and Max, plus mSin3B, a homolog of the yeast Sin3p." [PMID:7889570] is_a: GO:0043234 ! protein complex [Term] id: GO:0070443 name: Mad-Max complex namespace: cellular_component def: "A transcriptional repressor complex that consists of a heterodimer of the bHLH-ZIP proteins Mad and Max." [PMID:8224841] is_a: GO:0043234 ! protein complex [Term] id: GO:0071141 name: SMAD protein complex namespace: cellular_component def: "A protein complex that consists of SMAD proteins; may be homomeric or heteromeric." [GOC:mah, PMID:9670020] synonym: "SMAD complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0071142 name: SMAD2 protein complex namespace: cellular_component def: "A protein complex that consists of a SMAD2 homotrimer." [GOC:mah, PMID:9670020] synonym: "SMAD2 homotrimer complex" EXACT [] is_a: GO:0071141 ! SMAD protein complex [Term] id: GO:0071144 name: SMAD2-SMAD3 protein complex namespace: cellular_component def: "A heteromeric SMAD protein complex that contains SMAD2 and SMAD3." [GOC:mah, PMID:9670020] synonym: "SMAD2-SMAD3 complex" EXACT [] is_a: GO:0071141 ! SMAD protein complex [Term] id: GO:0071145 name: SMAD2-SMAD4 protein complex namespace: cellular_component def: "A heteromeric SMAD protein complex that contains SMAD2 and SMAD4." [GOC:mah, PMID:9670020] synonym: "SMAD2-SMAD4 heteromer complex" EXACT [] is_a: GO:0071141 ! SMAD protein complex [Term] id: GO:0071943 name: Myc-Max complex namespace: cellular_component def: "A transcriptional factor complex that consists of a heterodimer of the bHLH-ZIP proteins Myc and Max." [GOC:cna, PMID:16620027, PMID:16620031, PMID:20170194] is_a: GO:0043234 ! protein complex [Term] id: GO:0097071 name: interferon regulatory factor complex namespace: cellular_component def: "A protein complex that consists of two interferon regulatory proteins (IRFs); may be homodimeric or heterodimeric. The activation of a latent closed conformation of IRF in the cytoplasm is triggered by phosphorylation of Ser/Thr residues in a C-terminal region. Phosphorylation stimulates the C-terminal autoinhibitory domain to attain a highly extended conformation triggering dimerization through extensive contacts to a second subunit." [GOC:cna, PMID:20043992] synonym: "IRF complex" EXACT [] is_a: GO:0043234 ! protein complex [Term] id: GO:0097073 name: interferon regulatory factor 5 complex namespace: cellular_component def: "An interferon regulatory factor complex that consists of a homodimer of interferon regulatory factor 5." [GOC:cna, PMID:12138184, PMID:16751392] synonym: "IRF5:IRF5 complex" EXACT [] is_a: GO:0097071 ! interferon regulatory factor complex [Term] id: MOD:00006 name: N-glycosylated residue namespace: MOD synonym: "NGlycoRes" EXACT PSI-MOD-label [] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00030 name: N-formyl-L-methionine residue namespace: MOD synonym: "fMet" EXACT PSI-MOD-label [] is_a: PR:000002970 ! pre-translationally modified amino-acid residue [Term] id: MOD:00031 name: L-selenocysteine residue namespace: MOD synonym: "Sec" EXACT PSI-MOD-label [] is_a: PR:000002970 ! pre-translationally modified amino-acid residue [Term] id: MOD:00033 name: crosslinked residues namespace: MOD synonym: "XLNK" EXACT PSI-MOD-label [PRO:DAN] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00034 name: L-cystine (cross-link) namespace: MOD synonym: "Cys2" EXACT PSI-MOD-label [] is_a: MOD:00033 ! crosslinked residues [Term] id: MOD:00042 name: L-aspartic 4-phosphoric anhydride namespace: MOD synonym: "PhosAsp" EXACT PSI-MOD-label [] is_a: MOD:00696 ! phosphorylated residue [Term] id: MOD:00045 name: 3'-phospho-L-histidine synonym: "NpiPhosHis" EXACT PSI-MOD-label [] is_a: MOD:00696 ! phosphorylated residue [Term] id: MOD:00046 name: O-phospho-L-serine namespace: MOD synonym: "OPhosSer" EXACT PSI-MOD-label [] is_a: MOD:00696 ! phosphorylated residue [Term] id: MOD:00047 name: O-phospho-L-threonine namespace: MOD synonym: "OPhosThr" EXACT PSI-MOD-label [] is_a: MOD:00696 ! phosphorylated residue [Term] id: MOD:00048 name: O4'-phospho-L-tyrosine namespace: MOD synonym: "OPhosTyr" EXACT PSI-MOD-label [] is_a: MOD:00696 ! phosphorylated residue [Term] id: MOD:00050 name: N-acetyl-L-alanine namespace: MOD synonym: "AcAla" EXACT PSI-MOD-label [] is_a: MOD:00394 ! acetylated residue [Term] id: MOD:00064 name: N6-acetyl-L-lysine namespace: MOD synonym: "N6AcLys" EXACT PSI-MOD-label [] is_a: MOD:00394 ! acetylated residue [Term] id: MOD:00078 name: omega-N-methyl-L-arginine namespace: MOD synonym: "NoMeArg" EXACT PSI-MOD-label [] is_a: MOD:00427 ! methylated residue [Term] id: MOD:00083 name: N6,N6,N6-trimethyl-L-lysine namespace: MOD synonym: "N6Me3+Lys" EXACT PSI-MOD-label [] is_a: MOD:00427 ! methylated residue [Term] id: MOD:00087 name: N6-myristoyl-L-lysine namespace: MOD synonym: "N6MyrLys" EXACT PSI-MOD-label [] is_a: MOD:00438 ! myristoylated residue [Term] id: MOD:00113 name: S-geranylgeranyl-L-cysteine namespace: MOD synonym: "SGergerCys" EXACT PSI-MOD-label [] is_a: MOD:00703 ! isoprenylated residue [Term] id: MOD:00127 name: N6-lipoyl-L-lysine namespace: MOD synonym: "LipoLys" EXACT PSI-MOD-label [PRO:DAN] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00128 name: N6-pyridoxal phosphate-L-lysine namespace: MOD synonym: "PyridLys" EXACT PSI-MOD-label [PRO:DAN] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00160 name: N4-glycosyl-L-asparagine namespace: MOD synonym: "N4GlycoAsn" EXACT PSI-MOD-label [] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00213 name: chondroitin sulfate D-glucuronosyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine namespace: MOD synonym: "ChondSer" EXACT PSI-MOD-label [PRO:DAN] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00215 name: heparan sulfate D-glucuronosyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine namespace: MOD synonym: "HepSer" EXACT PSI-MOD-label [PRO:DAN] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00222 name: 2'-alpha-mannosyl-L-tryptophan namespace: MOD synonym: "C2'ManTrp" EXACT PSI-MOD-label [] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00237 name: L-beta-methylthioaspartic acid namespace: MOD synonym: "BMeThyAsp" EXACT PSI-MOD-label [PRO:DAN] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00394 name: acetylated residue namespace: MOD synonym: "AcRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00396 name: O-glycosylated residue namespace: MOD synonym: "OGlycoRes" EXACT PSI-MOD-label [] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00427 name: methylated residue namespace: MOD synonym: "MeRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00438 name: myristoylated residue namespace: MOD synonym: "MyrRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00448 name: N-acetylaminoglucosylated residue namespace: MOD synonym: "GlcNAcRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00693 name: glycosylated residue namespace: MOD synonym: "GlycoRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00696 name: phosphorylated residue namespace: MOD synonym: "PhosRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00703 name: isoprenylated residue namespace: MOD synonym: "IpRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00723 name: N-acetylated L-lysine namespace: MOD synonym: "NAcLys" EXACT PSI-MOD-label [] is_a: MOD:00394 ! acetylated residue [Term] id: MOD:00783 name: dimethylated L-arginine namespace: MOD synonym: "NNMe2Arg" EXACT PSI-MOD-label [] is_a: MOD:00427 ! methylated residue [Term] id: MOD:00806 name: O-(N-acetylamino)glucosyl-L-threonine namespace: MOD synonym: "OGlcNAcThr" EXACT PSI-MOD-label [] is_a: MOD:00448 ! N-acetylaminoglucosylated residue [Term] id: MOD:00812 name: O-fucosyl-L-serine namespace: MOD synonym: "OFucSer" EXACT PSI-MOD-label [] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00813 name: O-fucosyl-L-threonine namespace: MOD synonym: "OFucThr" EXACT PSI-MOD-label [] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00814 name: O-xylosyl-L-serine namespace: MOD synonym: "OXylSer" EXACT PSI-MOD-label [] is_a: MOD:00693 ! glycosylated residue [Term] id: MOD:00818 name: glycosylphosphatidylinositolated residue namespace: MOD synonym: "GPIRes" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:00822 name: S-(L-leucyl)-L-cysteine namespace: MOD synonym: "XLNK1LeuSCys" EXACT PSI-MOD-label [] is_a: MOD:00033 ! crosslinked residues [Term] id: MOD:01048 name: 2-pyrrolidone-5-carboxylic acid namespace: MOD synonym: "PyrGlu" EXACT PSI-MOD-label [] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:01148 name: ubiquitinylated lysine namespace: MOD synonym: "UbiqLys" EXACT PSI-MOD-label [PRO:DAN] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:01149 name: sumoylated lysine namespace: MOD synonym: "SumoLys" EXACT PSI-MOD-label [PRO:DAN] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:01150 name: neddylated lysine namespace: MOD synonym: "NeddLys" EXACT PSI-MOD-label [PRO:DAN] is_a: PR:000002968 ! post-translationally modified amino-acid residue [Term] id: MOD:01187 name: L-pyrrolysine residue namespace: MOD synonym: "Pyl" EXACT PSI-MOD-label [] is_a: PR:000002970 ! pre-translationally modified amino-acid residue [Term] id: MOD:01240 name: ubiquitination signature tetrapeptidyl lysine namespace: MOD synonym: "XLNK4PepLys" EXACT PSI-MOD-label [PRO:DAN] is_a: MOD:00033 ! crosslinked residues [Term] id: NCBITaxon:571 name: Klebsiella oxytoca namespace: taxon synonym: "Bacillus oxytocus perniciosus" RELATED [] synonym: "Klebsiella oxytoca (Flugge 1886) Lautrop 1956" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:10029 name: Cricetulus griseus namespace: taxon synonym: "Chinese hamster" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:10090 name: Mus musculus namespace: taxon synonym: "mouse" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:10116 name: Rattus norvegicus namespace: taxon synonym: "rat" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:13689 name: Sphingomonas paucimobilis namespace: taxon synonym: "Bacillus devorans" RELATED [] synonym: "Chromobacterium devorans" RELATED [] synonym: "Flavobacterium devorans" RELATED [] synonym: "Pseudomonas paucimobilis" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:1404 name: Bacillus megaterium namespace: taxon synonym: "Bacillus fructosus" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:1423 name: Bacillus subtilis namespace: taxon is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:1773 name: Mycobacterium tuberculosis namespace: taxon synonym: "Bacillus tuberculosis" RELATED [] synonym: "Bacterium tuberculosis" RELATED [] synonym: "Mycobacterium tuberculosis typus humanus" RELATED [] synonym: "Mycobacterium tuberculosis var. hominis" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:28454 name: Sphingobacterium multivorum namespace: taxon synonym: "Cytophaga keratolytica" RELATED [] synonym: "Flavobacterium keratolyticus" RELATED [] synonym: "Flavobacterium multivorum" RELATED [] synonym: "group IIk, biotype 2" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:284812 name: Schizosaccharomyces pombe 972h- namespace: taxon is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:392499 name: Sphingomonas wittichii namespace: taxon synonym: "Sphingomonas wittichii RW1" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:4565 name: Triticum aestivum namespace: taxon synonym: "wheat" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:4932 name: Saccharomyces cerevisiae namespace: taxon synonym: "Baker's yeast" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:5062 name: Aspergillus oryzae namespace: taxon is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:5271 name: Ustilago sphaerogena namespace: taxon synonym: "smut fungus" BROAD [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:83333 name: Escherichia coli (strain K12) namespace: taxon synonym: "E. coli K12" EXACT [] synonym: "Escherichia coli K-12" EXACT [] synonym: "Escherichia coli K12" EXACT [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:9031 name: Gallus gallus namespace: taxon synonym: "chicken" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:90371 name: Salmonella enterica subsp. enterica serovar Typhimurium namespace: taxon synonym: "Bacillus typhimurium" RELATED [] synonym: "Salmonella choleraesuis serotype typhimurium" RELATED [] synonym: "Salmonella enterica 1,4,[5],12,:i:1,2" RELATED [] synonym: "Salmonella enterica ser. typhimurium" RELATED [] synonym: "Salmonella enterica serotype Typhimurium" RELATED [] synonym: "Salmonella enterica serovar Typhimurium" RELATED [] synonym: "Salmonella enterica subsp. enterica serovar 1,4,[5],12,:i:1,2" RELATED [] synonym: "Salmonella typhi-murium" RELATED [] synonym: "Salmonella typhimurium" RELATED [] synonym: "Samonella typhimurium" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:9534 name: Chlorocebus aethiops namespace: taxon synonym: "African green monkey" EXACT [] synonym: "African green monkeys" EXACT [] synonym: "Cercopithecus aethiops" EXACT [] synonym: "green monkey" EXACT [] synonym: "grivet" EXACT [] synonym: "savanah monkey" EXACT [] synonym: "vervet monkey" EXACT [] synonym: "Ceropithecus aethiops" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:9606 name: Homo sapiens namespace: taxon synonym: "human" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:9615 name: Canis familiaris namespace: taxon synonym: "dog" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:9823 name: Sus scrofa namespace: taxon synonym: "pig" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:9913 name: Bos taurus namespace: taxon synonym: "cow" RELATED [] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:197911 name: Influenzavirus A namespace: taxon is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:359391 name: Brucella melitensis biovar Abortus 2308 namespace: taxon synonym: "Brucella melitensis biovar Abortus str. 2308" EXACT [] synonym: "Brucella melitensis biovar Abortus strain 2308" EXACT [] synonym: "Brucella abortus (strain 2308)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:262698 name: Brucella abortus bv. 1 str. 9-941 namespace: taxon synonym: "Brucella abortus bv. 1 strain 9-941" EXACT [] synonym: "Brucella abortus biovar 1 str. 9-941" EXACT [] synonym: "Brucella abortus biovar 1 (strain 9-941)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:483179 name: Brucella canis ATCC 23365 namespace: taxon synonym: "Brucella canis str. ATCC 23365" EXACT [] synonym: "Brucella canis strain ATCC 23365" EXACT [] synonym: "Brucella canis (strain atcc 23365 / nctc 10854)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:546272 name: Brucella melitensis ATCC 23457 namespace: taxon synonym: "Brucella melitensis str. ATCC 23457" EXACT [] synonym: "Brucella melitensis strain ATCC 23457" EXACT [] synonym: "Brucella melitensis biotype 2 (strain atcc 23457)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:444178 name: Brucella ovis ATCC 25840 namespace: taxon synonym: "Brucella ovis strain ATCC 25840" EXACT [] synonym: "Brucella ovis str. ATCC 25840" EXACT [] synonym: "Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:470137 name: Brucella suis ATCC 23445 namespace: taxon synonym: "Brucella suis str. ATCC 23445" EXACT [] synonym: "Brucella suis strain ATCC 23445" EXACT [] synonym: "Brucella suis (strain atcc 23445 / nctc 10510)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:204722 name: Brucella suis 1330 namespace: taxon synonym: "Brucella melitensis biovar Suis str. 1330" RELATED [] synonym: "Brucella suis NCTC 10316" RELATED [] synonym: "Brucella suis ATCC 23444" RELATED [] synonym: "Brucella suis str. 1330" EXACT [] synonym: "Brucella suis biovar 1 (strain 1330)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:224914 name: Brucella melitensis bv. 1 str. 16M namespace: taxon synonym: "Brucella melitensis ATCC 23456" RELATED [] synonym: "Brucella melitensis str. 16M" RELATED [] synonym: "Brucella melitensis str. ATCC 23456" RELATED [] synonym: "Brucella melitensis 16M" RELATED [] synonym: "Brucella melitensis biotype 1 (strain 16m / atcc 23456 / nctc 10094)" EXACT [PRO:CNA] is_a: OBI:0100026 ! organism [Term] id: NCBITaxon:3702 name: Arabidopsis thaliana namespace: taxon synonym: "mouse-ear cress" EXACT [] synonym: "thale-cress" EXACT [] synonym: "thale cress" EXACT [] synonym: "Arbisopsis thaliana" RELATED [] synonym: "Arabidopsis thaliana (thale cress)" RELATED [] is_a: OBI:0100026 ! organism [Term] id: OBI:0100026 name: organism namespace: OBI is_a: snap:Object ! object [Term] id: PR:000000001 name: protein def: "An amino acid chain that is produced de novo by ribosome-mediated translation of a genetically-encoded mRNA." [PRO:DAN, PRO:WCB] comment: Proteins descended from a common ancestor can be classified into families and superfamilies composed of products of evolutionarily-related genes. The domain architecture of a protein is described by the order of its constituent domains. Proteins with the same domains in the same order are defined as homeomorphic [PRO:WCB]. is_a: PR:000018263 ! amino acid chain [Term] id: PR:000000002 name: E3 ubiquitin ligase SFC complex Skp1 subunit def: "A protein with a core domain composition consisting of an N-terminal Skp1 family, tetramerisation domain (PF03931) followed by a Skp1 family, dimerisation domain (PF01466). Skp1 proteins bind several F-box-containing proteins, and are involved in the ubiquitin protein degradation pathway." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF028729 is_a: PR:000000001 ! protein [Term] id: PR:000000003 name: HLH DNA-binding protein inhibitor def: "A protein that belongs to the clade D of the bHLH proteins (see PMID:20219281) with a core domain composition consisting of a helix-loop-helix DNA-binding domain (PF00010) (HLH), common to the basic HLH family of transcription factors, but lacking the DNA binding domain to the consensus E box response element (CANNTG). By binding to basic HLH transcription factors, proteins in this class regulate gene expression." [PRO:CNA, PMID:20219281] comment: Category=family. synonym: "DNA-binding protein inhibitor ID" EXACT [] synonym: "ID protein" RELATED [] synonym: "bHLH clade D" BROAD [PMID:20219281] synonym: "bHLH class V" BROAD [PMID:8018712] xref: PIRSF:PIRSF005808 is_a: PR:000000001 ! protein [Term] id: PR:000000004 name: RING-box protein def: "A protein with a core domain composition consisting of a Zinc finger, C3HC4 type (RING finger)(PF00097) domain." [PMID:11573242] comment: Category=family. xref: PIRSF:PIRSF016237 is_a: PR:000000001 ! protein [Term] id: PR:000000005 name: TGF-beta receptor type-2 def: "A protein that is a translation product of the TGFBR2 gene or a 1:1 ortholog thereof. The core domain organization is composed of a signal peptide followed by a Transforming growth factor beta receptor 2 ectodomain (PF08917), a transmembrane domain and a C-terminal Protein kinase domain (PF00069)." [PRO:CNA] comment: Category=gene. synonym: "TGFBR2" EXACT PRO-short-label [] synonym: "TbetaR-II" EXACT [] synonym: "TGF-beta receptor type II" EXACT [] synonym: "TGF-beta type II receptor" EXACT [] synonym: "TGFR-2" EXACT [] synonym: "transforming growth factor-beta receptor type II" EXACT [] xref: PIRSF:PIRSF037393 is_a: PR:000000001 ! protein [Term] id: PR:000000006 name: TGF-beta superfamily receptor type-1 def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of an extracellular Activin types I and II receptor domain (PF01064), a transmembrane domain, a Transforming growth factor beta type I GS-motif (PF08515) and a Protein kinase domain (PF00069). The transforming growth factor-beta (TGF-beta) superfamily of receptors comprises two groups of transmembrane serine-threonine kinase receptors, so called type-1, and type-2 receptors, that are activated following engagement by members of the TGF-beta superfamily of ligands. These events specify diverse downstream responses that are differentially regulated by controlling access and activation of the ligands, their receptors and downstream substrates in different cell types. The type 1 receptors are characterized by the presence of a glycine-serine rich juxta-membrane domain (the GS-motif) that is critical for their activation." [PRO:CNA] comment: Category=family. synonym: "TRANSFORMING GROWTH FACTOR-BETA RECEPTOR TYPE I (PTHR23255:SF15)" EXACT [] xref: PANTHER:PTHR23255\:SF14 xref: PIRSF:PIRSF037391 is_a: PR:000000001 ! protein [Term] id: PR:000000007 name: TGF-beta superfamily receptor type-2 with activin receptor domain def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of an extracellular Activin types I and II receptor domain (PF01064), a transmembrane domain, and a Protein kinase domain (PF00069). The transforming growth factor-beta (TGF-beta) superfamily of receptors comprises two groups of transmembrane serine-threonine kinase receptors, so called type-1, and type-2 receptors, that are activated following engagement by members of the TGF-beta superfamily of ligands. These events specify diverse downstream responses that are differentially regulated by controlling access and activation of the ligands, their receptors and downstream substrates in different cell types." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF000627 is_a: PR:000000001 ! protein [Term] id: PR:000000008 name: TGF-beta-like cystine-knot cytokine def: "A protein with a core domain composition consisting of a signal peptide, a variable propeptide region and a Transforming growth factor beta like domain (PF00019), which is a cystine-knot domain containing four conserved beta strands, S1-S4, which form two antiparallel beta sheets (SI-S2 and S3-S4) interconnected by three disulfide bridges in a knot-like topology. Cystines [II-V] and [III-VI] form a ring through which the remaining disulfide bond (Cys[I-IV]) penetrates. Insertion of different variable regions into this common motif has given rise to various subclasses of the growth factor cystine-knot domain." [PRO:CNA] comment: Category=family. synonym: "TGF-beta superfamily" RELATED [] xref: PIRSF:PIRSF800009 is_a: PR:000000001 ! protein [Term] id: PR:000000009 name: anti-Muellerian hormone type-2 receptor def: "A protein that is a translation product of the AMHR2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "AMHR2" EXACT PRO-short-label [] synonym: "AMH type II receptor" EXACT [] synonym: "anti-Muellerian hormone type II receptor" EXACT [] synonym: "MIS type II receptor" EXACT [] synonym: "MISRII" EXACT [] synonym: "MRII" EXACT [] synonym: "AMHR" RELATED [] is_a: PR:000000001 ! protein [Term] id: PR:000000010 name: chordin def: "A protein that is a translation product of the CHRD gene or a 1:1 ortholog thereof. Chordin regulates signaling by BMP pathway." [PRO:CNA] comment: Category=gene. synonym: "CHRD" EXACT PRO-short-label [] xref: PIRSF:PIRSF002496 is_a: PR:000000001 ! protein [Term] id: PR:000000011 name: class 1 small leucine-rich proteoglycan def: "A protein with a core domain composition consisting of eight to ten tandem leucine-rich repeat sequences that are flanked at either end by cysteine rich disulfide loops." [PMID:14562268] comment: Category=family. xref: PIRSF:PIRSF002490 is_a: PR:000000001 ! protein [Term] id: PR:000000012 name: creb-binding protein/zinc finger protein HRX chimera def: "A protein that is a translation product of the fusion of CREBBP and MYST4 genes." [PRO:CNA] comment: Wrong name, replaced by PR:000003507. is_obsolete: true replaced_by: PR:000003507 [Term] id: PR:000000013 name: cullin def: "A protein with a core domain composition consisting of a cullin domain that functions as a molecular scaffold responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases." [PIRSF:PIRSF017874] comment: Category=family. xref: PIRSF:PIRSF017874 is_a: PR:000000001 ! protein [Term] id: PR:000000014 name: cyclin-dependent kinase inhibitor def: "A protein with a core domain composition consisting of four ankyrin repeats, and that functions as negative regulator of cyclin-dependent kinases." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF036346 is_a: PR:000000001 ! protein [Term] id: PR:000000015 name: follistatin def: "A protein that is a translation product of the FST gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "FST" EXACT PRO-short-label [] synonym: "activin-binding protein" EXACT [] synonym: "FS" EXACT [] xref: PIRSF:PIRSF002278 is_a: PR:000000001 ! protein [Term] id: PR:000000016 name: HECT domain-containing E3 ubiquitin-protein ligase with WW domains def: "A protein with a core domain composition consisting of the C-terminal HECT-domain (ubiquitin-transferase) (F00632), which is catalytically involved in the attachment of ubiquitin to substrate proteins, and an N-terminal extension with a C2 domain (PF00168) and two to three copies of the WW domain (PF00397) that mediate the substrate specificity." [PMID:18047743] comment: Category=family. xref: PIRSF:PIRSF001569 is_a: PR:000000001 ! protein [Term] id: PR:000000017 name: interferon gamma def: "A protein that is a translation product of the IFNG gene or a 1:1 ortholog thereof. The core domain structure consists of an Interferon gamma domain (PF00714) that is four-helical cytokine domain with an additional helix in one of the crossover connections. It is a cytokine produced by lymphocytes activated by specific antigens or mitogens that has important immunoregulatory functions." [PRO:CNA] comment: Category=gene. synonym: "IFNG" EXACT PRO-short-label [] synonym: "IFN-gamma" EXACT [] synonym: "immune interferon" EXACT [] xref: PIRSF:PIRSF001936 is_a: PR:000000001 ! protein [Term] id: PR:000000018 name: latent TGF-beta-binding protein def: "A protein similar in overall domain structure to fibrillins, that is mainly composed of two types of repeated protein domains, namely epidermal growth factor (EGF-like) and TB (8-Cys-like repeats). The latent TGF-beta-binding protein is characterized by having four of the TB domains." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF037569 is_a: PR:000000001 ! protein [Term] id: PR:000000019 name: mitogen-activated protein kinase def: "A protein that is a serine/threonine-specific protein kinase that responds to extracellular stimuli (mitogens) and regulates cellular activities such as gene expression, mitosis, differentiation, and cell survival/apoptosis. The activated form phosphorylates target substrates on Ser or Thr residues followed by a proline. A distinguishing feature is the conserved sequence TxY." [PRO:CNA, Wikipedia:Mitogen-activated_protein_kinase] comment: Category=family. synonym: "kinase-related transforming protein" RELATED [] xref: PIRSF:PIRSF501110 is_a: PR:000000001 ! protein [Term] id: PR:000000020 name: myc protein def: "A protein that belongs to the clade B of the bHLH proteins (see PMID:20219281) with a core domain composition consisting of a Myc amino-terminal region (PF01056) regulatory domain (known as TAD domain), a helix-loop-helix DNA-binding domain (PF00010). Some members such as c-Myc contains an addition C-terminal Myc leucine zipper domain (PF02344). Myc proteins participate in the regulation of cell proliferation, cell differentiation, and apoptosis." [PMID:16113099, PMID:16537894, PMID:16543245, PRO:CNA] comment: Category=family. synonym: "bHLH clade B" BROAD [PMID:20219281] synonym: "bHLH class III" BROAD [PMID:8018712] xref: PIRSF:PIRSF001705 is_a: PR:000000001 ! protein [Term] id: PR:000000021 name: noggin def: "A protein that is a translation product of the NOG gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "NOG" EXACT PRO-short-label [] xref: PANTHER:PTHR10494\:SF2 xref: PIRSF:PIRSF008129 is_a: PR:000000001 ! protein [Term] id: PR:000000022 name: ptx homeobox protein def: "A protein with a core domain composition consisting of an N-terminal K50 class Homeobox domain (PF00046) and a C-terminal OAR domain (PF03826). The homeobox domain consists of a self-folding, stable protein domain of 60 amino acids in which position 50 can confer a distinct DNA binding specificity. The K50 class of homeodomains recognizes a consensus DNA sequence of TAATCC. Homeodomain-containing proteins are known to play important roles in such diverse activities as embryonic pattern formation, cell-type specification, and differentiation." [PMID:15895993] comment: Category=family. xref: PIRSF:PIRSF000563 is_a: PR:000000001 ! protein [Term] id: PR:000000023 name: retinoblastoma-like protein def: "A protein with a core domain composition consisting of a Retinoblastoma-associated protein A domain (PF01858) followed by a Retinoblastoma-associated protein B domain (PF01857). The retinoblastoma-like proteins are key regulators of entry into cell division. They are directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF037408 is_a: PR:000000001 ! protein [Term] id: PR:000000024 name: rho-associated protein kinase def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of an N-terminal Protein kinase domain (PF00069), a Rho Binding domain (PF08912), and a PH domain (PF00169) and a Phorbol esters/diacylglycerol binding domain (C1 domain) (PF00130) at the C-terminus. Rho-associated protein kinases are mediators of many cellular processes by being effectors of the small GTP-binding protein Rho." [PRO:CNA] comment: Category=family. synonym: "RHO-ASSOCIATED, COILED-COIL CONTAINING PROTEIN KINASE (PTHR22988:SF3)" EXACT [] xref: PIRSF:PIRSF037568 is_a: PR:000000001 ! protein [Term] id: PR:000000025 name: ribosomal protein S6 kinase beta def: "A protein that specifically phosphorylates ribosomal protein S6 in response to insulin and other mitogens. It has a core domain composition consisting of a Protein kinase domain (PF00069) followed by a Protein kinase C terminal domain (PF00433)." [PRO:CNA] comment: Category=family. xref: PANTHER:PTHR24351\:SF83 xref: PIRSF:PIRSF000605 is_a: PR:000000001 ! protein [Term] id: PR:000000026 name: smad anchor for receptor activation def: "A protein with a core domain composition consisting of a FYVE zinc finger (PF01363) domain and a smad-binding domain that is involved in recruiting and presenting receptor-regulated smads to the receptor complex." [PMID:17356069] comment: Category=family. xref: PIRSF:PIRSF037289 is_a: PR:000000001 ! protein [Term] id: PR:000000027 name: smad protein def: "A protein with core domain composition consisting of one MH1 domain (PF03165) at the N-terminus and one MH2 domain (PF03166) at the C-terminus, separated by a non-conserved linker region. Smad proteins are mediators of signal transduction in transforming growth factor beta (TGF-beta) superfamily pathways." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF037286 is_a: PR:000000001 ! protein [Term] id: PR:000000028 name: small GTPase def: "A protein with a core domain composition consisting of a Ras family domain (PF00071). The small GTPases are monomeric G-proteins which function as GDP/GTP-regulated molecular switches." [PMID:15731001] comment: Category=family. is_a: PR:000000001 ! protein [Term] id: PR:000000029 name: thrombospondin subgroup A def: "A protein with a core domain composition consisting of a procollagen homology domain and three TSR domains at the N-terminus followed by three or four EGF-type repeats, a series of seven contiguous calcium-binding repeats (the thrombospondin type 3 repeats), and a globular carboxyl-terminal domain." [PMID:10842357] comment: Category=family. xref: PIRSF:PIRSF002478 is_a: PR:000000001 ! protein [Term] id: PR:000000030 name: thrombospondin subgroup B def: "A protein with a core domain composition consisting of three or four EGF-type repeats, a series of seven contiguous calcium-binding repeats (the thrombospondin type 3 repeats), and a globular carboxyl-terminal domain." [PMID:10842357] comment: Category=family. xref: PIRSF:PIRSF002479 is_a: PR:000000001 ! protein [Term] id: PR:000000031 name: transcription adapter with TAZ, KIX and bromo-domains def: "A protein with a core domain composition consisting of a TAZ zinc finger (PF02135) domain, a KIX domain (PF02172), a Bromodomain (PF00439), a dystrophin zinc finger domain, and a second copy of the TAZ zinc finger (PF02135) domain." [PRO:CNA] comment: Category=family. synonym: "CBP/p300" EXACT [] xref: PANTHER:PTHR13808 xref: PIRSF:PIRSF036333 is_a: PR:000000001 ! protein [Term] id: PR:000000032 name: transcription factor Sp def: "A protein that is a translation product of an evolutionary-related gene with core domain composition consisting of N-terminal serine/threonine stretches adjacent to one or two glutamine-rich domains, which constitute the activation domains, and three copies of the Zinc finger, C2H2 type (PF00096) domain at the C-terminus that are involved in binding GC/GT-rich promoter elements." [PMID:16209919] comment: Category=family. xref: PIRSF:PIRSF037570 is_a: PR:000000001 ! protein [Term] id: PR:000000033 name: tumor necrosis factor, TNF-like def: "A protein with a core domain composition consisting of an N-terminal cytosolic domain, a type II transmembrane domain and a C-terminal TNF domain (PF00229)." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF001873 is_a: PR:000000001 ! protein [Term] id: PR:000000034 name: BMP def: "A TGF-beta-like cystine-knot cytokine related to the transforming growth factor-beta, anti-Muellerian hormone, and activin/inhibin protein families, which are all involved in the regulation of cell growth and differentiation. These are produced as dimeric precursors and undergo post-translational processing for activation, requiring cleavage to release bioactive the C-terminal peptide. BMP is involved in body patterning and morphogenesis. BMP signals are transmitted through specific type 2 and type 1 receptors." [PIRSF:PIRSF037272] comment: Category=family. xref: PIRSF:PIRSF037272 is_a: PR:000000008 ! TGF-beta-like cystine-knot cytokine [Term] id: PR:000000035 name: BMP receptor type-1A def: "A TGF-beta superfamily receptor type-1 that is a translation product of the BMPR1A gene or a 1:1 ortholog thereof. Bone morphogenetic protein (BMP) signals are transmitted by type 2 and type 1 serine/threonine kinase receptors. Type 2 receptors phosphorylate and activate type 1 receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2 and BMP4." [PRO:CNA] comment: Category=gene. synonym: "BMPR1A" EXACT PRO-short-label [] synonym: "activin receptor-like kinase 3" EXACT [] synonym: "ALK-3" EXACT [] synonym: "BMP type-1A receptor" EXACT [] synonym: "BMP-2/BMP-4 receptor" EXACT [] synonym: "BMPR-1A" EXACT [] synonym: "CD292" EXACT [] synonym: "serine/threonine-protein kinase receptor R5" EXACT [] synonym: "SKR5" EXACT [] synonym: "ACVRLK3" RELATED [] synonym: "ALK3" RELATED [] synonym: "Bmpr" RELATED [] is_a: PR:000000006 ! TGF-beta superfamily receptor type-1 [Term] id: PR:000000036 name: BMP receptor type-1B def: "A TGF-beta superfamily receptor type-1 that is a translation product of the BMPR1B gene or a 1:1 ortholog thereof. Bone morphogenetic protein (BMP) signals are transmitted by type 2 and type 1 serine/threonine kinase receptors. Type 2 receptors phosphorylate and activate type 1 receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMPS/OP-1." [PRO:CNA] comment: Category=gene. synonym: "BMPR1B" EXACT PRO-short-label [] synonym: "activin receptor-like kinase 6" EXACT [] synonym: "ALK-6" EXACT [] synonym: "BMP type-1B receptor" EXACT [] synonym: "BMPR-1B" EXACT [] synonym: "CDw293" EXACT [] synonym: "serine/threonine-protein kinase receptor R6" EXACT [] synonym: "SKR6" EXACT [] synonym: "Acvrlk6" RELATED [] is_a: PR:000000006 ! TGF-beta superfamily receptor type-1 [Term] id: PR:000000037 name: BMP receptor type-2 def: "A TGF-beta superfamily receptor type-2 with activin receptor domain that is a translation product of the BMPR2 gene or a 1:1 ortholog thereof. Bone morphogenetic protein (BMP) signals are transmitted by type 2 and type 1 serine/threonine kinase receptors. Type 2 receptors phosphorylate and activate type 1 receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators." [PRO:CNA] comment: Category=gene. synonym: "BMPR2" EXACT PRO-short-label [] synonym: "BMP type II receptor" EXACT [] synonym: "BMP type-2 receptor" EXACT [] synonym: "BMPR-2" EXACT [] synonym: "BMPR-II" EXACT [] synonym: "bone morphogenetic protein receptor type II" EXACT [] synonym: "BRK-3" EXACT [] synonym: "PPH1" RELATED [] xref: PIRSF:PIRSF500434 is_a: PR:000000007 ! TGF-beta superfamily receptor type-2 with activin receptor domain [Term] id: PR:000000038 name: BMP receptor-regulated smad protein def: "A smad protein which mediates signal transduction through activation of bone morphogenetic protein (BMP) or anti-Mullerian hormone pathways." [PMID:11532220] comment: Category=family. xref: PANTHER:PTHR13703\:SF19 xref: PIRSF:PIRSF500500 is_a: PR:000000027 ! smad protein [Term] id: PR:000000039 name: DNA-binding protein inhibitor ID-1 def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID1 gene or a 1:1 ortholog thereof. This gene has two conserved protein coding exons." [PRO:CNA] comment: Category=gene. synonym: "ID1" EXACT PRO-short-label [] synonym: "bHLHb24" EXACT [] synonym: "class B basic helix-loop-helix protein 24" EXACT [] synonym: "inhibitor of DNA binding 1" EXACT [] synonym: "ID" RELATED [] synonym: "Id-1" RELATED [] synonym: "Idb1" RELATED [] xref: PIRSF:PIRSF500477 is_a: PR:000000003 ! HLH DNA-binding protein inhibitor [Term] id: PR:000000040 name: DNA-binding protein inhibitor ID-2 def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ID2" EXACT PRO-short-label [] synonym: "bHLHb26" EXACT [] synonym: "class B basic helix-loop-helix protein 26" EXACT [] synonym: "inhibitor of DNA binding 2" EXACT [] synonym: "Id-2" RELATED [] synonym: "Idb2" RELATED [] xref: PIRSF:PIRSF500498 is_a: PR:000000003 ! HLH DNA-binding protein inhibitor [Term] id: PR:000000041 name: DNA-binding protein inhibitor ID-3 def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ID3" EXACT PRO-short-label [] synonym: "bHLHb25" EXACT [] synonym: "class B basic helix-loop-helix protein 25" EXACT [] synonym: "helix-loop-helix protein HEIR-1" EXACT [] synonym: "ID-like protein inhibitor HLH 1R21" EXACT [] synonym: "ID-like protein inhibitor HLH 462" EXACT [] synonym: "inhibitor of DNA binding 3" EXACT [] synonym: "1R21" RELATED [] synonym: "HEIR1" RELATED [] synonym: "Hlh462" RELATED [] synonym: "Id-3" RELATED [] synonym: "Idb3" RELATED [] xref: PIRSF:PIRSF500479 is_a: PR:000000003 ! HLH DNA-binding protein inhibitor [Term] id: PR:000000042 name: DNA-binding protein inhibitor ID-4 def: "A HLH DNA-binding protein inhibitor that is a translation product of the ID4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ID4" EXACT PRO-short-label [] synonym: "bHLHb27" EXACT [] synonym: "class B basic helix-loop-helix protein 27" EXACT [] synonym: "inhibitor of DNA binding 4" EXACT [] synonym: "Id-4" RELATED [] synonym: "Idb4" RELATED [] xref: PIRSF:PIRSF500478 is_a: PR:000000003 ! HLH DNA-binding protein inhibitor [Term] id: PR:000000043 name: RING-box protein 1 def: "A RING-box protein 1 related protein that is a translation product of the RBX1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "RBX1" EXACT PRO-short-label [] synonym: "protein ZYP" EXACT [] synonym: "rbx1" EXACT [] synonym: "regulator of cullins 1" EXACT [] synonym: "RING finger protein 75" EXACT [] synonym: "RNF75" RELATED [] synonym: "ROC1" RELATED [] is_a: PR:000027961 ! RING-box protein 1 related protein [Term] id: PR:000000044 name: RING-box protein 2 def: "A protein that is a translation product of the RNF7 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "RNF7" EXACT PRO-short-label [] synonym: "CKBBP1" EXACT [] synonym: "CKII beta-binding protein 1" EXACT [] synonym: "rbx2" EXACT [] synonym: "regulator of cullins 2" EXACT [] synonym: "RING finger protein 7" EXACT [] synonym: "sensitive to apoptosis gene protein" EXACT [] synonym: "ROC2" RELATED [] synonym: "SAG" RELATED [] xref: PIRSF:PIRSF500725 is_a: PR:000000004 ! RING-box protein [Term] id: PR:000000045 name: S-phase kinase-associated protein 1A def: "An E3 ubiquitin ligase SFC complex Skp1 subunit that is a translation product of the SKP1 gene or a 1:1 ortholog thereof. This gene has 5 conserved protein coding exons." [PRO:CNA] comment: Category=gene. synonym: "SKP1" EXACT PRO-short-label [] synonym: "cyclin-A/CDK2-associated protein p19" EXACT [] synonym: "OCP-2" EXACT [] synonym: "OCP-II" EXACT [] synonym: "organ of Corti protein 2" EXACT [] synonym: "organ of Corti protein II" EXACT [] synonym: "p19A" EXACT [] synonym: "p19skp1" EXACT [] synonym: "RNA polymerase II elongation factor-like protein" EXACT [] synonym: "S-phase kinase-associated protein 1A" EXACT [] synonym: "SIII" EXACT [] synonym: "transcription elongation factor B" EXACT [] synonym: "EMC19" RELATED [] synonym: "OCP2" RELATED [] synonym: "SKP1A" RELATED [] synonym: "TCEB1L" RELATED [] is_a: PR:000000002 ! E3 ubiquitin ligase SFC complex Skp1 subunit [Term] id: PR:000000046 name: TGF-beta def: "A TGFB-like cystine-knot cytokine whose propeptide region is a latent associated peptide (LAP) that remains associated to the mature TGF-beta after cleavage and secretion, keeping TGF-beta inactive. TGF-beta is the founding member of the cystine-knot cytokine family, and is related to the activin/inhibin, anti-Muellerian hormone, and bone morphogenic protein families, which are all involved in the regulation of cell growth and differentiation." [PIRSF:PIRSF001787] comment: Category=family. synonym: "transforming growth factor beta" RELATED [] xref: PIRSF:PIRSF001787 is_a: PR:000000008 ! TGF-beta-like cystine-knot cytokine [Term] id: PR:000000047 name: TGF-beta receptor type-1 def: "A TGF-beta superfamily receptor type-1 that is a translation product of the TGFBR1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "TGFBR1" EXACT PRO-short-label [] synonym: "activin receptor-like kinase 5" EXACT [] synonym: "ALK-5" EXACT [] synonym: "ESK2" EXACT [] synonym: "serine/threonine-protein kinase receptor R4" EXACT [] synonym: "SKR4" EXACT [] synonym: "TbetaR-I" EXACT [] synonym: "TGF-beta receptor type I" EXACT [] synonym: "TGF-beta type I receptor" EXACT [] synonym: "TGFR-1" EXACT [] synonym: "transforming growth factor-beta receptor type I" EXACT [] is_a: PR:000000006 ! TGF-beta superfamily receptor type-1 [Term] id: PR:000000048 name: TGF-beta receptor type-2 isoform 1 def: "A TGF-beta receptor type-2 that is a translation product of a mature transcript of the TGFBR2 gene, and that includes the core domains. Represented by the sequence UniProtKB:Q62312-2." [PMID:7957954] comment: Category=sequence. synonym: "TGFBR2/iso:1" EXACT PRO-short-label [] synonym: "Isoform RII-1" EXACT [] is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000049 name: TGF-beta receptor type-2 isoform 2 def: "A TGF-beta receptor type-2 that is a translation product of a mature transcript of the TGFBR2 gene, and that includes the core domains with an insertion of approximately 25 amino acids in the ectodomain just adjacent to the signal peptide. Represented by the sequence UniProtKB:Q62312-1." [PMID:7957954] comment: Category=sequence. synonym: "TGFBR2/iso:2" EXACT PRO-short-label [] synonym: "Isoform RII-2" EXACT [] is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000050 name: TGF-beta receptor type-2 sequence variant 1 def: "A TGF-beta receptor type-2 that has a Pro residue at the position equivalent to Leu-308 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000051 name: TGF-beta receptor type-2 sequence variant 10 def: "A TGF-beta receptor type-2 that has a His residue at the position equivalent to Arg-460 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000052 name: TGF-beta receptor type-2 sequence variant 11 def: "A TGF-beta receptor type-2 that has a Cys residue at the position equivalent to Arg-460 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000053 name: TGF-beta receptor type-2 sequence variant 12 def: "A TGF-beta receptor type-2 that has a Glu residue at the position equivalent to Gln-526 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000054 name: TGF-beta receptor type-2 sequence variant 13 def: "A TGF-beta receptor type-2 that has a Cys residue at the position equivalent to Arg-528 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000055 name: TGF-beta receptor type-2 sequence variant 14 def: "A TGF-beta receptor type-2 that has a His residue at the position equivalent to Arg-528 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000056 name: TGF-beta receptor type-2 sequence variant 15 def: "A TGF-beta receptor type-2 that has a Cys residue at the position equivalent to Arg-537 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000057 name: TGF-beta receptor type-2 sequence variant 16 def: "A TGF-beta receptor type-2 that has a Trp residue at the position equivalent to Gly-357 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000058 name: TGF-beta receptor type-2 sequence variant 2 def: "A TGF-beta receptor type-2 that has a Met residue at the position equivalent to Thr-315 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000059 name: TGF-beta receptor type-2 sequence variant 3 def: "A TGF-beta receptor type-2 that has an Asn residue at the position equivalent to Tyr-336 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000060 name: TGF-beta receptor type-2 sequence variant 4 def: "A TGF-beta receptor type-2 that has a Pro residue at the position equivalent to Ala-355 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000061 name: TGF-beta receptor type-2 sequence variant 5 def: "A TGF-beta receptor type-2 that has a Met residue at the position equivalent to Val-387 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000062 name: TGF-beta receptor type-2 sequence variant 6 def: "A TGF-beta receptor type-2 that has a Ser residue at the position equivalent to Asn-435 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000063 name: TGF-beta receptor type-2 sequence variant 7 def: "A TGF-beta receptor type-2 that has an Ala residue at the position equivalent to Val-447 in human sequence UniProtKB:P37173-1. This form is involved in breast tumors." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000064 name: TGF-beta receptor type-2 sequence variant 8 def: "A TGF-beta receptor type-2 that has a Phe residue at the position equivalent to Ser-449 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000065 name: TGF-beta receptor type-2 sequence variant 9 def: "A TGF-beta receptor type-2 that has a Met residue at the position equivalent to Leu-452 in human sequence UniProtKB:P37173-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000005 ! TGF-beta receptor type-2 [Term] id: PR:000000066 name: TGF-beta receptor-regulated smad protein def: "A smad protein that mediates signal transduction through activation of transforming growth factor beta (TGF-beta) or activin pathways." [PMID:11532220] comment: Category=family. xref: PIRSF:PIRSF500455 is_a: PR:000000027 ! smad protein [Term] id: PR:000000067 name: activin receptor type-1 def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVR1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ACVR1" EXACT PRO-short-label [] synonym: "activin receptor type I" EXACT [] synonym: "activin receptor-like kinase 2" EXACT [] synonym: "ACTR-I" EXACT [] synonym: "ALK-2" EXACT [] synonym: "serine/threonine-protein kinase receptor R1" EXACT [] synonym: "SKR1" EXACT [] synonym: "TSK-7L" EXACT [] synonym: "ACVRLK2" RELATED [] synonym: "TGF-B superfamily receptor type I" RELATED [] synonym: "Tgfb1" RELATED [] synonym: "TSR-I" RELATED [] is_a: PR:000000006 ! TGF-beta superfamily receptor type-1 [Term] id: PR:000000068 name: activin receptor type-1B def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVR1B gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ACVR1B" EXACT PRO-short-label [] synonym: "activin receptor type IB" EXACT [] synonym: "activin receptor-like kinase 4" EXACT [] synonym: "ACTR-IB" EXACT [] synonym: "ALK-4" EXACT [] synonym: "serine/threonine-protein kinase receptor R2" EXACT [] synonym: "SKR2" EXACT [] synonym: "ACVRLK4" RELATED [] synonym: "ALK4" RELATED [] is_a: PR:000000006 ! TGF-beta superfamily receptor type-1 [Term] id: PR:000000069 name: activin receptor type-1C def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVR1C gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ACVR1C" EXACT PRO-short-label [] synonym: "activin receptor type IC" EXACT [] synonym: "activin receptor-like kinase 7" EXACT [] synonym: "ACTR-IC" EXACT [] synonym: "ALK-7" EXACT [] synonym: "ALK7" RELATED [] is_a: PR:000000006 ! TGF-beta superfamily receptor type-1 [Term] id: PR:000000070 name: activin receptor type-2A def: "A TGF-beta superfamily receptor type-2 with activin receptor domain that is a translation product of the ACVR2A gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ACVR2A" EXACT PRO-short-label [] synonym: "activin receptor type IIA" EXACT [] synonym: "ACTR-IIA" EXACT [] synonym: "ACTRIIA" EXACT [] synonym: "ACVR2" RELATED [] xref: PIRSF:PIRSF500457 is_a: PR:000000007 ! TGF-beta superfamily receptor type-2 with activin receptor domain [Term] id: PR:000000071 name: activin receptor type-2B def: "A TGF-beta superfamily receptor type-2 with activin receptor domain that is a translation product of the ACVR2B gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ACVR2B" EXACT PRO-short-label [] synonym: "activin receptor type IIB" EXACT [] synonym: "ACTR-IIB" EXACT [] xref: PIRSF:PIRSF500456 is_a: PR:000000007 ! TGF-beta superfamily receptor type-2 with activin receptor domain [Term] id: PR:000000072 name: activin/inhibin beta subunit def: "A TGF-beta-like cystine-knot cytokine that is the beta subunit of inhibin and activin complexes. Related to the transforming growth factor-beta, anti-Muellerian hormone, and bone morphogenic protein families which are all involved in the regulation of cell growth and differentiation." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF037268 is_a: PR:000000008 ! TGF-beta-like cystine-knot cytokine [Term] id: PR:000000073 name: anti-Muellerian hormone def: "A TGF-beta-like cystine-knot cytokine that is a translation product of the AMH gene or a 1:1 ortholog thereof. Related to the transforming growth factor-beta, activin/inhibin, and bone morphogenic protein families which are all involved in the regulation of cell growth and differentiation." [PRO:CNA] comment: Category=gene. synonym: "AMH" EXACT PRO-short-label [] synonym: "anti-Muellerian hormone" EXACT [] synonym: "muellerian-inhibiting substance" EXACT [] synonym: "MIF" RELATED [] synonym: "MIS" RELATED [] xref: PIRSF:PIRSF037270 is_a: PR:000000008 ! TGF-beta-like cystine-knot cytokine [Term] id: PR:000000074 name: anti-Muellerian hormone type-2 receptor isoform 1 def: "An anti-Muellerian hormone type-2 receptor that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q16671-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "AMHR2/iso:1" EXACT PRO-short-label [] is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000075 name: anti-Muellerian hormone type-2 receptor sequence variant 1 def: "An anti-Muellerian hormone type-2 receptor that has a Cys residue at the position equivalent to Arg-54 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000076 name: anti-Muellerian hormone type-2 receptor sequence variant 2 def: "An anti-Muellerian hormone type-2 receptor that has a Val residue at the position equivalent to Gly-142 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000077 name: anti-Muellerian hormone type-2 receptor sequence variant 3 def: "An anti-Muellerian hormone type-2 receptor that has a Gln residue at the position equivalent to His-282 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000078 name: anti-Muellerian hormone type-2 receptor sequence variant 4 def: "An anti-Muellerian hormone type-2 receptor that has a Gln residue at the position equivalent to Arg-406 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000079 name: anti-Muellerian hormone type-2 receptor sequence variant 5 def: "An anti-Muellerian hormone type-2 receptor that has a Gly residue at the position equivalent to Asp-426 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000080 name: anti-Muellerian hormone type-2 receptor sequence variant 6 def: "An anti-Muellerian hormone type-2 receptor that has an Ala residue at the position equivalent to Val-458 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000081 name: anti-Muellerian hormone type-2 receptor sequence variant 7 def: "An anti-Muellerian hormone type-2 receptor that has a His residue at the position equivalent to Asp-491 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000082 name: anti-Muellerian hormone type-2 receptor sequence variant 8 def: "An anti-Muellerian hormone type-2 receptor that has a Cys residue at the position equivalent to Arg-504 in human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000083 name: anti-Muellerian hormone type-2 receptor sequence variant 9 def: "An anti-Muellerian hormone type-2 receptor that has an amino acid deletion at the position equivalent to region 444-452 in the human sequence UniProtKB:Q16671-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000009 ! anti-Muellerian hormone type-2 receptor [Term] id: PR:000000084 name: c-myc protein def: "A myc protein that is a translation product of the MYC gene or a 1:1 ortholog thereof. The gene has 3 exons, with exon 1 lacking ATG codons." [PRO:CNA] comment: Category=gene. synonym: "MYC" EXACT PRO-short-label [] synonym: "bHLHe39" EXACT [] synonym: "class E basic helix-loop-helix protein 39" EXACT [] synonym: "proto-oncogene c-Myc" EXACT [] synonym: "transcription factor p64" EXACT [] is_a: PR:000000020 ! myc protein [Term] id: PR:000000085 name: cartilage oligomeric matrix protein def: "A thrombospondin subgroup B that is a translation product of the COMP gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "COMP" EXACT PRO-short-label [] synonym: "thrombospondin-5" EXACT [] synonym: "TSP5" EXACT [] is_a: PR:000000030 ! thrombospondin subgroup B [Term] id: PR:000000086 name: chordin isoform 1 def: "A chordin that is a translation product of a mature transcript of the CHRD gene, and that is the precursor with the signal peptide, one N-terminal and three C-terminal von Willebrand factor type C domains, and four chrd domains in between. Represented by the sequence UniProtKB:Q9H2X0-1." [PMID:10479448, PRO:CNA] comment: Category=sequence. synonym: "CHRD/iso:1" EXACT PRO-short-label [] is_a: PR:000000010 ! chordin [Term] id: PR:000000087 name: chordin isoform 2 def: "A chordin that is a translation product of a mature transcript of the CHRD gene that is a truncated protein with only the signal peptide and a partial N-terminal von Willebrand factor type C domain. Represented by the sequence UniProtKB:Q9H2X0-2." [PMID:11472837, PRO:CNA] comment: Category=sequence. synonym: "CHRD/iso:2" EXACT PRO-short-label [] synonym: "P-CR1" RELATED [] is_a: PR:000000010 ! chordin [Term] id: PR:000000088 name: chordin isoform 3 def: "A chordin that is a translation product of a mature transcript of the CHRD gene that is a truncated protein with the signal peptide, the N-terminal von Willebrand factor type C domain, and one partial chrd domain. Represented by the sequence UniProtKB:Q9H2X0-4." [PMID:11472837, PRO:CNA] comment: Category=sequence. synonym: "CHRD/iso:3" EXACT PRO-short-label [] is_a: PR:000000010 ! chordin [Term] id: PR:000000089 name: chordin isoform 4 def: "A chordin that is a translation product of a mature transcript of the CHRD gene that is a truncated protein with the signal peptide, the N-terminal and only 1 C-terminal von Willebrand factor type C domain, and four chrd domains in between. Represented by the sequence UniProtKB:Q9H2X0-5." [PRO:CNA] comment: Category=sequence. synonym: "CHRD/iso:4" EXACT PRO-short-label [] synonym: "CHRD sequence 4 cleaved-1" EXACT [] is_a: PR:000000010 ! chordin [Term] id: PR:000000090 name: creb-binding protein def: "A transcription adapter with TAZ, KIX and bromo-domains that is a translation product of the CREBBP gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "CREBBP" EXACT PRO-short-label [] synonym: "CBP" RELATED [] is_a: PR:000000031 ! transcription adapter with TAZ, KIX and bromo-domains [Term] id: PR:000000091 name: creb-binding protein/zinc finger protein HRX def: "A creb-binding protein/zinc finger protein HRX product which consists of part of CREBBP gene at the N-terminus and part of MYST4 gene at the C-terminus. This form is observed in some cases of acute myelogenous leukemia where chromosomal translocation occurs." [PMID:11157802] comment: Wrong name. Replaced by PR:000003508. synonym: "CBP/MORF" RELATED [] is_obsolete: true replaced_by: PR:000003508 [Term] id: PR:000000092 name: fungal/metazoan cullin-1 def: "A cullin that is a translation product of the CUL1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "CUL1" EXACT PRO-short-label [] synonym: "CUL-1" EXACT [] xref: PANTHER:PTHR11932:SF19 is_a: PR:000000013 ! cullin [Term] id: PR:000000093 name: cyclin-dependent kinase 4 inhibitor B def: "A cyclin-dependent kinase inhibitor that is a translation product of the CDKN2B gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "CDKN2B" EXACT PRO-short-label [] synonym: "MTS-2" EXACT [] synonym: "multiple tumor suppressor 2" EXACT [] synonym: "p14-INK4b" EXACT [] synonym: "p15-INK4b" EXACT [] synonym: "p15INK4B" EXACT [] synonym: "MTS2" RELATED [] xref: PANTHER:PTHR24144\:SF138 is_a: PR:000000014 ! cyclin-dependent kinase inhibitor [Term] id: PR:000000094 name: decorin def: "A class 1 small leucine-rich proteoglycan that is a translation product of the DCN gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "DCN" EXACT PRO-short-label [] synonym: "bone proteoglycan II" EXACT [] synonym: "PG-S2" EXACT [] synonym: "PG40" EXACT [] synonym: "SLRR1B" RELATED [] is_a: PR:000000011 ! class 1 small leucine-rich proteoglycan [Term] id: PR:000000095 name: fas ligand, TNF-like def: "A tumor necrosis factor that is a translation product of the FASLG gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "FASLG" EXACT PRO-short-label [] synonym: "apoptosis antigen ligand" EXACT [] synonym: "APTL" EXACT [] synonym: "CD178" EXACT [] synonym: "CD95 ligand" EXACT [] synonym: "CD95-L" EXACT [] synonym: "Fas antigen ligand" EXACT [] synonym: "Fas ligand" EXACT [] synonym: "APT1LG1" RELATED [] synonym: "CD95L" RELATED [] synonym: "FASL" RELATED [] synonym: "gld" RELATED [] synonym: "TNFSF6" RELATED [] xref: PANTHER:PTHR11471\:SF7 is_a: PR:000000033 ! tumor necrosis factor, TNF-like [Term] id: PR:000000096 name: follistatin isoform 1 def: "A follistatin that is a translation product of a mature transcript of the FST gene including all protein coding exons, and is the precursor of the mature protein. Represented by the sequence UniProtKB:P19883-1." [PRO:CNA] comment: Category=sequence. synonym: "FST/iso:1" EXACT PRO-short-label [] is_a: PR:000000015 ! follistatin [Term] id: PR:000000097 name: follistatin isoform 2 def: "A follistatin that is a translation product of a mature transcript of the FST gene, without the C-terminal acidic region. Represented by the sequence UniProtKB:P19883-2." [PMID:8340384] comment: Category=sequence. synonym: "FST/iso:2" EXACT PRO-short-label [] synonym: "FS288" RELATED [] is_a: PR:000000015 ! follistatin [Term] id: PR:000000098 name: growth/differentiation factor def: "A TGF-beta-like cystine-knot cytokine closely related to the BMP family. These are produced as dimeric precursors and undergo post-translational processing for activation, requiring cleavage to release the bioactive C-terminal peptide. GDFs act as signaling molecules during embryonic tendon/ligament formation." [PRO:CNA] comment: Category=family. is_a: PR:000000008 ! TGF-beta-like cystine-knot cytokine [Term] id: PR:000000099 name: inhibitory smad protein def: "A smad protein that is an antagonist of the transforming growth factor beta (TGF-beta) superfamily signaling pathways. It lacks the C-terminal SSxS motif, necessary for receptor mediated phosphorylation that is present in the receptor-regulated smads." [PMID:11532220] comment: Category=family. xref: PIRSF:PIRSF500412 is_a: PR:000000027 ! smad protein [Term] id: PR:000000100 name: interferon gamma isoform 1 def: "An interferon gamma that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:P01579-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "IFNG/iso:1" EXACT PRO-short-label [] is_a: PR:000000017 ! interferon gamma [Term] id: PR:000000101 name: latent TGF-beta-binding protein 1 def: "A latent TGF-beta-binding protein that is a translation product of the LTBP1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "LTBP1" EXACT PRO-short-label [] synonym: "LTBP-1" EXACT [] synonym: "TGF-beta1-BP-1" EXACT [] synonym: "transforming growth factor beta-1-binding protein 1" EXACT [] is_a: PR:000000018 ! latent TGF-beta-binding protein [Term] id: PR:000000102 name: lefty protein def: "A TGF-beta-like cystine-knot cytokine that is an antagonist of nodal signaling. The nodal and lefty genes form positive and negative regulatory loops that resemble the reaction-diffusion system. As a pair, these genes control various events of vertebrate embryonic patterning, including left-right specification and mesoderm formation." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF037402 is_a: PR:000000008 ! TGF-beta-like cystine-knot cytokine [Term] id: PR:000000103 name: mitogen-activated protein kinase 1 def: "A mitogen-activated protein kinase that is a translation product of the MAPK1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "MAPK1" EXACT PRO-short-label [] synonym: "ERK-2" EXACT [] synonym: "ERT1" EXACT [] synonym: "extracellular signal-regulated kinase 2" EXACT [] synonym: "MAP kinase 1" EXACT [] synonym: "MAP kinase 2" EXACT [] synonym: "MAP kinase isoform p42" EXACT [] synonym: "MAPK 1" EXACT [] synonym: "MAPK 2" EXACT [] synonym: "mitogen-activated protein kinase 2" EXACT [] synonym: "p42-MAPK" EXACT [] synonym: "ERK2" RELATED [] synonym: "Mapk" RELATED [] synonym: "PRKM1" RELATED [] synonym: "PRKM2" RELATED [] is_a: PR:000000019 ! mitogen-activated protein kinase [Term] id: PR:000000104 name: mitogen-activated protein kinase 3 def: "A mitogen-activated protein kinase that is a translation product of the MAPK3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "MAPK3" EXACT PRO-short-label [] synonym: "ERK-1" EXACT [] synonym: "ERT2" EXACT [] synonym: "extracellular signal-regulated kinase 1" EXACT [] synonym: "insulin-stimulated MAP2 kinase" EXACT [] synonym: "MAP kinase 3" EXACT [] synonym: "MAP kinase isoform p44" EXACT [] synonym: "MAPK 3" EXACT [] synonym: "microtubule-associated protein 2 kinase" EXACT [] synonym: "MNK1" EXACT [] synonym: "p44-ERK1" EXACT [] synonym: "p44-MAPK" EXACT [] synonym: "ERK1" RELATED [] synonym: "MAP kinase 1" RELATED [] synonym: "MAPK 1" RELATED [] synonym: "mitogen-activated protein kinase 1" RELATED [] synonym: "PRKM3" RELATED [] is_a: PR:000000019 ! mitogen-activated protein kinase [Term] id: PR:000000105 name: nodal protein def: "A TGF-beta-like cystine-knot cytokine that is a translation product of the NODAL gene or a 1:1 ortholog thereof. The nodal and lefty genes form positive and negative regulatory loops that resemble the reaction-diffusion system. As a pair, these genes control various events of vertebrate embryonic patterning, including left-right specification and mesoderm formation." [PRO:CNA] comment: Category=gene. synonym: "NODAL" EXACT PRO-short-label [] xref: PIRSF:PIRSF037400 is_a: PR:000000008 ! TGF-beta-like cystine-knot cytokine [Term] id: PR:000000106 name: noggin isoform 1 def: "A noggin that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q13253-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "NOG/iso:1" EXACT PRO-short-label [] is_a: PR:000000021 ! noggin [Term] id: PR:000000107 name: noggin sequence variant 1 def: "A noggin that has a Ser residue at the position equivalent to Pro-35 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000108 name: noggin sequence variant 10 def: "A noggin that has a Leu residue at the position equivalent to Pro-223 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000109 name: noggin sequence variant 2 def: "A noggin that has an Arg residue at the position equivalent to Pro-35 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000110 name: noggin sequence variant 3 def: "A noggin that has a Tyr residue at the position equivalent to Cys-184 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000111 name: noggin sequence variant 4 def: "A noggin that has a Cys residue at the position equivalent to Gly-189 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000112 name: noggin sequence variant 5 def: "A noggin that has a Leu residue at the position equivalent to Arg-204 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000113 name: noggin sequence variant 6 def: "A noggin that has a Gly residue at the position equivalent to Trp-217 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000114 name: noggin sequence variant 7 def: "A noggin that has an Asn residue at the position equivalent to Ile-220 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000115 name: noggin sequence variant 8 def: "A noggin that has a Cys residue at the position equivalent to Tyr-222 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000116 name: noggin sequence variant 9 def: "A noggin that has an Asp residue at the position equivalent to Tyr-222 in the human sequence UniProtKB:Q13253-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000021 ! noggin [Term] id: PR:000000117 name: pituitary homeobox protein 2 def: "A ptx homeobox protein that is a translation product of the PITX2 gene or a 1:1 ortholog thereof. The PITX2 gene contains 6 conserved exons." [PRO:CNA] comment: Category=gene. synonym: "PITX2" EXACT PRO-short-label [] synonym: "ALL1-responsive protein ARP1" EXACT [] synonym: "BRX1 homeoprotein" EXACT [] synonym: "homeobox protein PITX2" EXACT [] synonym: "orthodenticle-like homeobox 2" EXACT [] synonym: "paired-like homeodomain transcription factor 2" EXACT [] synonym: "paired-like homeodomain transcription factor Munc 30" EXACT [] synonym: "RIEG bicoid-related homeobox transcription factor" EXACT [] synonym: "solurshin" EXACT [] synonym: "ARP1" RELATED [] synonym: "Brx1" RELATED [] synonym: "Otlx2" RELATED [] synonym: "Ptx2" RELATED [] synonym: "RGS" RELATED [] synonym: "RIEG" RELATED [] synonym: "RIEG1" RELATED [] is_a: PR:000000022 ! ptx homeobox protein [Term] id: PR:000000118 name: retinoblastoma-like protein 1 def: "A retinoblastoma-like protein that is a translation product of the RBL1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "RBL1" EXACT PRO-short-label [] synonym: "107 kDa retinoblastoma-associated protein" EXACT [] synonym: "p107" EXACT [] synonym: "pRb1" EXACT [] is_a: PR:000000023 ! retinoblastoma-like protein [Term] id: PR:000000119 name: retinoblastoma-like protein 2 def: "A retinoblastoma-like protein that is a translation product of the RBL2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "RBL2" EXACT PRO-short-label [] synonym: "130 kDa retinoblastoma-associated protein" EXACT [] synonym: "p130" EXACT [] synonym: "pRb2" EXACT [] synonym: "RBR-2" EXACT [] synonym: "retinoblastoma-related protein 2" EXACT [] synonym: "RB2" RELATED [] is_a: PR:000000023 ! retinoblastoma-like protein [Term] id: PR:000000120 name: rho-associated protein kinase 1 def: "A rho-associated protein kinase that is a translation product of the ROCK1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ROCK1" EXACT PRO-short-label [] synonym: "p160 ROCK-1" EXACT [] synonym: "p160ROCK" EXACT [] synonym: "renal carcinoma antigen NY-REN-35" EXACT [] synonym: "rho-associated, coiled-coil-containing protein kinase 1" EXACT [] is_a: PR:000000024 ! rho-associated protein kinase [Term] id: PR:000000121 name: rho-associated protein kinase 2 def: "A rho-associated protein kinase that is a translation product of the ROCK2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ROCK2" EXACT PRO-short-label [] synonym: "p164 ROCK-2" EXACT [] synonym: "rho kinase 2" EXACT [] synonym: "rho-associated, coiled-coil-containing protein kinase 2" EXACT [] synonym: "KIAA0619" RELATED [] is_a: PR:000000024 ! rho-associated protein kinase [Term] id: PR:000000122 name: rho-related small GTPase def: "A small GTPase with a short insert (approximately 13 residues) coincident with loop 8 of Ras. This insert region forms a highly charged helix without dramatic disturbance of the global structure shared with other small GTPases. Rho-related small GTPases act as key transducers of extracellular signals to regulate the actin cytoskeleton, cell cycle progression and gene expression." [PMID:11463812] comment: Category=family. xref: PIRSF:PIRSF037169 is_a: PR:000000028 ! small GTPase [Term] id: PR:000000123 name: ribosomal protein S6 kinase beta-1 def: "A ribosomal protein S6 kinase beta that is a translation product of the RPS6KB1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "RPS6KB1" EXACT PRO-short-label [] synonym: "70 kDa ribosomal protein S6 kinase 1" EXACT [] synonym: "p70 ribosomal S6 kinase alpha" EXACT [] synonym: "p70 S6 kinase alpha" EXACT [] synonym: "p70 S6K-alpha" EXACT [] synonym: "p70 S6KA" EXACT [] synonym: "p70-S6K 1" EXACT [] synonym: "P70S6K1" EXACT [] synonym: "ribosomal protein S6 kinase I" EXACT [] synonym: "S6K" EXACT [] synonym: "S6K-beta-1" EXACT [] synonym: "S6K1" EXACT [] synonym: "serine/threonine-protein kinase 14A" EXACT [] synonym: "STK14A" RELATED [] is_a: PR:000000025 ! ribosomal protein S6 kinase beta [Term] id: PR:000000124 name: ribosomal protein S6 kinase beta-2 def: "A ribosomal protein S6 kinase beta that is a translation product of the RPS6KB2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "RPS6KB2" EXACT PRO-short-label [] synonym: "70 kDa ribosomal protein S6 kinase 2" EXACT [] synonym: "p70 ribosomal S6 kinase beta" EXACT [] synonym: "p70 S6 kinase beta" EXACT [] synonym: "p70 S6K-beta" EXACT [] synonym: "p70 S6KB" EXACT [] synonym: "p70-beta" EXACT [] synonym: "p70-S6K 2" EXACT [] synonym: "P70S6K2" EXACT [] synonym: "S6 kinase-related kinase" EXACT [] synonym: "S6K-beta" EXACT [] synonym: "S6K-beta-2" EXACT [] synonym: "S6K2" EXACT [] synonym: "serine/threonine-protein kinase 14B" EXACT [] synonym: "SRK" EXACT [] synonym: "STK14B" RELATED [] is_a: PR:000000025 ! ribosomal protein S6 kinase beta [Term] id: PR:000000125 name: sara def: "A smad anchor for receptor activation that is a translation product of the ZFYVE9 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ZFYVE9" EXACT PRO-short-label [] synonym: "hSARA" EXACT [] synonym: "Madh-interacting protein" EXACT [DNx] synonym: "mothers against decapentaplegic homolog-interacting protein" EXACT [] synonym: "novel serine protease" EXACT [] synonym: "receptor activation anchor" EXACT [] synonym: "smad anchor for receptor activation" EXACT [] synonym: "MADHIP" RELATED [] synonym: "NSP" RELATED [] synonym: "SARA" RELATED [] synonym: "SMADIP" RELATED [] is_a: PR:000000026 ! smad anchor for receptor activation [Term] id: PR:000000126 name: serine/threonine-protein kinase receptor R3 def: "A TGF-beta superfamily receptor type-1 that is a translation product of the ACVRL1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "ACVRL1" EXACT PRO-short-label [] synonym: "activin receptor-like kinase 1" EXACT [] synonym: "ALK-1" EXACT [] synonym: "SKR3" EXACT [] synonym: "ACVRLK1" RELATED [] synonym: "ALK1" RELATED [] synonym: "TGF-B superfamily receptor type I" RELATED [] synonym: "TSR-I" RELATED [] is_a: PR:000000006 ! TGF-beta superfamily receptor type-1 [Term] id: PR:000000127 name: smad ubiquitination regulatory factor def: "A HECT-domain-containing E3 ubiquitin-protein ligase with WW domains that mediates smad ubiquitination." [PRO:CNA] comment: Category=family. synonym: "smurf" EXACT [] xref: PIRSF:PIRSF500454 is_a: PR:000000016 ! HECT domain-containing E3 ubiquitin-protein ligase with WW domains [Term] id: PR:000000128 name: smad4 def: "A smad protein that is a translation product of the SMAD4 gene or a 1:1 ortholog thereof. It lacks the C-terminal SSxS motif, necessary for receptor mediated phosphorylation, that is present in the receptor-regulated smads." [PMID:10708949, PRO:CNA] comment: Category=gene. synonym: "SMAD4" EXACT PRO-short-label [] synonym: "deletion target in pancreatic carcinoma 4" EXACT [] synonym: "deletion target in pancreatic carcinoma 4 homolog" EXACT [] synonym: "hSMAD4" EXACT [] synonym: "MAD homolog 4" EXACT [] synonym: "mothers against DPP homolog 4" EXACT [] synonym: "SMAD 4" EXACT [] synonym: "SMAD family member 4" EXACT [] synonym: "DPC4" RELATED [] synonym: "MADH4" RELATED [] xref: PIRSF:PIRSF500408 is_a: PR:000000027 ! smad protein [Term] id: PR:000000129 name: thrombospondin-1 def: "A thrombospondin subgroup A that is a translation product of the THBS1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "THBS1" EXACT PRO-short-label [] synonym: "TSP" RELATED [] synonym: "TSP1" RELATED [] xref: PANTHER:PTHR10199\:SF37 is_a: PR:000000029 ! thrombospondin subgroup A [Term] id: PR:000000130 name: thrombospondin-2 def: "A thrombospondin subgroup A that is a translation product of the THBS2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "THBS2" EXACT PRO-short-label [] synonym: "TSP2" RELATED [] is_a: PR:000000029 ! thrombospondin subgroup A [Term] id: PR:000000131 name: thrombospondin-3 def: "A thrombospondin subgroup B that is a translation product of the THBS3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "THBS3" EXACT PRO-short-label [] synonym: "TSP3" RELATED [] is_a: PR:000000030 ! thrombospondin subgroup B [Term] id: PR:000000132 name: thrombospondin-4 def: "A thrombospondin subgroup B that is a translation product of the THBS4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "THBS4" EXACT PRO-short-label [] synonym: "TSP4" RELATED [] is_a: PR:000000030 ! thrombospondin subgroup B [Term] id: PR:000000133 name: transcription factor Sp1 def: "A transcription factor Sp that is a translation product of the SP1 gene or a 1:1 ortholog thereof. It comprises the exons that code for an N-terminal inhibitory domain, two serine/threonine stretches adjacent to activation domains and three zinc fingers." [PRO:CNA] comment: Category=gene. synonym: "SP1" EXACT PRO-short-label [] synonym: "TSFP1" RELATED [] xref: PANTHER:PTHR23235\:SF4 xref: PIRSF:PIRSF500820 is_a: PR:000000032 ! transcription factor Sp [Term] id: PR:000000134 name: tumor necrosis factor alpha def: "A tumor necrosis factor, TNF-like that is a translation product of the TNF gene or a 1:1 ortholog thereof. Tumour necrosis factor alpha (TNF) is a pleiotropic cytokine that mediates apoptosis, cell proliferation, immunomodulation, inflammation, viral replication, allergy, arthritis, septic shock, insulin resistance, autoimmune diseases, and other pathological conditions. TNF transduces these cellular responses through two distinct receptors: type I, which are expressed on all cell types, and type II, which are expressed only on cells of the immune system and endothelial cells." [PMID:11053079, PRO:CNA] comment: Category=gene. synonym: "TNF" EXACT PRO-short-label [] synonym: "cachectin" EXACT [] synonym: "TNF-a" EXACT [] synonym: "TNF-alpha" EXACT [] synonym: "tumor necrosis factor ligand superfamily member 2" EXACT [] synonym: "TNFA" RELATED [] synonym: "TNFSF2" RELATED [] xref: PIRSF:PIRSF500467 is_a: PR:000000033 ! tumor necrosis factor, TNF-like [Term] id: PR:000000135 name: zinc finger protein HRX/creb-binding protein def: "A creb-binding protein/zinc finger protein HRX product which consists of part of MYST4 gene at the N-terminus and part of CREBBP gene at the C-terminus. It includes the zinc fingers, 2 nuclear localization signals, the histone acetyltransferase (HAT) domain, a portion of the acidic domain of MYST4, and the zinc fingers, KIX domain, bromodomain and CREB-binding domain from CREBBP. This form is observed in some cases of acute myelogenous leukemia where chromosomal translocation occurs." [PMID:11157802] comment: Wrong name. Replaced by PR:000003509. synonym: "MORF/CBP" RELATED [] is_obsolete: true replaced_by: PR:000003509 [Term] id: PR:000000136 name: BMP receptor type-1A isoform 1 def: "A BMP receptor type-1A that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:P36894-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "BMPR1A/iso:1" EXACT PRO-short-label [] is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000137 name: BMP receptor type-1A sequence variant 1 def: "A BMP receptor type-1A that has an Asp residue at the position equivalent to Tyr-62 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000138 name: BMP receptor type-1A sequence variant 2 def: "A BMP receptor type-1A that has a Tyr residue at the position equivalent to Cys-82 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000139 name: BMP receptor type-1A sequence variant 3 def: "A BMP receptor type-1A that has an Arg residue at the position equivalent to Cys-124 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000140 name: BMP receptor type-1A sequence variant 4 def: "A BMP receptor type-1A that has an Arg residue at the position equivalent to Cys-130 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000141 name: BMP receptor type-1A sequence variant 5 def: "A BMP receptor type-1A that has an Asp residue at the position equivalent to Ala-338 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000142 name: BMP receptor type-1A sequence variant 6 def: "A BMP receptor type-1A that has a Tyr residue at the position equivalent to Cys-376 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000143 name: BMP receptor type-1A sequence variant 7 def: "A BMP receptor type-1A that has a Cys residue at the position equivalent to Arg-443 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000144 name: BMP receptor type-1A sequence variant 8 def: "A BMP receptor type-1A that has a Thr residue at the position equivalent to Met-470 in human sequence UniProtKB:P36894-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000035 ! BMP receptor type-1A [Term] id: PR:000000145 name: BMP receptor type-1B isoform 1 def: "A BMP receptor type-1B that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:O00238-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. Phosphorylation information from rat [PMID:9766532]. synonym: "BMPR1B/iso:1" EXACT PRO-short-label [] is_a: PR:000000036 ! BMP receptor type-1B [Term] id: PR:000000146 name: BMP receptor type-1B sequence variant 1 def: "A BMP receptor type-1B that has a Lys residue at the position equivalent to Ile-200 in human sequence UniProtKB:O00238-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000036 ! BMP receptor type-1B [Term] id: PR:000000147 name: BMP receptor type-1B sequence variant 2 def: "A BMP receptor type-1B that has a Trp residue at the position equivalent to Arg-486 in human sequence UniProtKB:O00238-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000036 ! BMP receptor type-1B [Term] id: PR:000000148 name: BMP receptor type-2 isoform 1 def: "A BMP receptor type-2 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q13873-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "BMPR2/iso:1" EXACT PRO-short-label [] is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000149 name: BMP receptor type-2 sequence variant 1 def: "A BMP receptor type-2 that has a Tyr residue at the position equivalent to Cys-60 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000150 name: BMP receptor type-2 sequence variant 10 def: "A BMP receptor type-2 that has a Gly residue at the position equivalent to Asp-485 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000151 name: BMP receptor type-2 sequence variant 11 def: "A BMP receptor type-2 that has a Gln residue at the position equivalent to Arg-491 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000152 name: BMP receptor type-2 sequence variant 12 def: "A BMP receptor type-2 that has a Trp residue at the position equivalent to Arg-491 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000153 name: BMP receptor type-2 sequence variant 13 def: "A BMP receptor type-2 that has a Thr residue at the position equivalent to Lys-512 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000154 name: BMP receptor type-2 sequence variant 14 def: "A BMP receptor type-2 that has a Lys residue at the position equivalent to Asn-519 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000155 name: BMP receptor type-2 sequence variant 2 def: "A BMP receptor type-2 that has a Tyr residue at the position equivalent to Cys-117 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000156 name: BMP receptor type-2 sequence variant 3 def: "A BMP receptor type-2 that has a Trp residue at the position equivalent to Cys-118 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000157 name: BMP receptor type-2 sequence variant 4 def: "A BMP receptor type-2 that has an Arg residue at the position equivalent to Cys-123 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000158 name: BMP receptor type-2 sequence variant 5 def: "A BMP receptor type-2 that has a Ser residue at the position equivalent to Cys-123 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000159 name: BMP receptor type-2 sequence variant 6 def: "A BMP receptor type-2 that has an Asp residue at the position equivalent to Glu-224 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000160 name: BMP receptor type-2 sequence variant 7 def: "A BMP receptor type-2 that has a Tyr residue at the position equivalent to Cys-347 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000161 name: BMP receptor type-2 sequence variant 8 def: "A BMP receptor type-2 that has an Arg residue at the position equivalent to Cys-420 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000162 name: BMP receptor type-2 sequence variant 9 def: "A BMP receptor type-2 that has an Arg residue at the position equivalent to Cys-483 in human sequence UniProtKB:Q13873-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000037 ! BMP receptor type-2 [Term] id: PR:000000163 name: BMP10 def: "A BMP that is a translation product of the BMP10 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP10" EXACT PRO-short-label [] synonym: "BMP-10" EXACT [] xref: PANTHER:PTHR11848\:SF39 is_a: PR:000000034 ! BMP [Term] id: PR:000000164 name: BMP2 def: "A BMP that is a translation product of the BMP2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP2" EXACT PRO-short-label [] synonym: "BMP-2" EXACT [] synonym: "BMP-2A" EXACT [] synonym: "bone morphogenetic protein 2A" EXACT [] synonym: "BMP2A" RELATED [] xref: PANTHER:PTHR11848\:SF50 is_a: PR:000000034 ! BMP [Term] id: PR:000000165 name: BMP4 def: "A BMP that is a translation product of the BMP4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP4" EXACT PRO-short-label [] synonym: "BMP-2B" EXACT [] synonym: "BMP-4" EXACT [] synonym: "bone morphogenetic protein 2B" EXACT [] synonym: "BMP2B" RELATED [] synonym: "Dvr-4" RELATED [] synonym: "DVR4" RELATED [] xref: PANTHER:PTHR11848\:SF49 is_a: PR:000000034 ! BMP [Term] id: PR:000000166 name: BMP5 def: "A BMP that is a translation product of the BMP5 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP5" EXACT PRO-short-label [] synonym: "BMP-5" EXACT [] is_a: PR:000000034 ! BMP [Term] id: PR:000000167 name: BMP6 def: "A BMP that is a translation product of the BMP6 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP6" EXACT PRO-short-label [] synonym: "BMP-6" EXACT [] synonym: "VG-1-R" EXACT [] synonym: "VG-1-related protein" EXACT [] synonym: "VGR-1" EXACT [] synonym: "VGR" RELATED [] synonym: "Vgr1" RELATED [] xref: PANTHER:PTHR11848\:SF55 is_a: PR:000000034 ! BMP [Term] id: PR:000000168 name: BMP7 def: "A BMP that is a translation product of the BMP7 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP7" EXACT PRO-short-label [] synonym: "BMP-7" EXACT [] synonym: "eptotermin alfa" EXACT [] synonym: "OP-1" EXACT [] synonym: "osteogenic protein 1" EXACT [] synonym: "OP1" RELATED [] is_a: PR:000000034 ! BMP [Term] id: PR:000000169 name: BMP8A def: "A BMP that is a translation product of the BMP8A gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP8A" EXACT PRO-short-label [] synonym: "BMP-8A" EXACT [] synonym: "Bmp-8" RELATED [] synonym: "Bmp8" RELATED [] synonym: "OP-2" BROAD [] synonym: "osteogenic protein 2" BROAD [] is_a: PR:000000034 ! BMP [Term] id: PR:000000170 name: BMP8B def: "A BMP that is a translation product of the BMP8B gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "BMP8B" EXACT PRO-short-label [] synonym: "BMP-8" EXACT [] synonym: "BMP-8B" EXACT [] synonym: "BMP8" RELATED [] synonym: "OP-2" BROAD [] synonym: "osteogenic protein 2" BROAD [] is_a: PR:000000034 ! BMP [Term] id: PR:000000171 name: DNA-binding protein inhibitor ID-1 isoform 1 def: "A DNA-binding protein inhibitor ID-1 that is a translation product of a mature transcript of the ID1 gene including all protein coding exons. Represented by the sequence UniProtKB:P41134-1." [PRO:CNA] comment: Category=sequence. synonym: "ID1/iso:1" EXACT PRO-short-label [] synonym: "ID-A" RELATED [] is_a: PR:000000039 ! DNA-binding protein inhibitor ID-1 [Term] id: PR:000000172 name: DNA-binding protein inhibitor ID-1 isoform 2 def: "A DNA-binding protein inhibitor ID-1 that is a translation product of a mature transcript of the ID1 gene including only the first coding exon and extending to the first stop codon. Represented by the sequence UniProtKB:P41134-2." [PRO:CNA] comment: Category=sequence. synonym: "ID1/iso:2" EXACT PRO-short-label [] synonym: "ID-B" RELATED [] is_a: PR:000000039 ! DNA-binding protein inhibitor ID-1 [Term] id: PR:000000173 name: DNA-binding protein inhibitor ID-2 isoform 1 def: "A DNA-binding protein inhibitor ID-2 that is a translation product of a mature transcript of the ID2 gene, and that contains an HLH domain and a C-terminal nuclear export signal. Represented by the sequence UniProtKB:Q02363-1." [PRO:CNA] comment: Category=sequence. synonym: "ID2/iso:1" EXACT PRO-short-label [] is_a: PR:000000040 ! DNA-binding protein inhibitor ID-2 [Term] id: PR:000000174 name: DNA-binding protein inhibitor ID-3 isoform 1 def: "A DNA-binding protein inhibitor ID-3 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q02535-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "ID3/iso:1" EXACT PRO-short-label [] is_a: PR:000000041 ! DNA-binding protein inhibitor ID-3 [Term] id: PR:000000175 name: DNA-binding protein inhibitor ID-4 isoform 1 def: "A DNA-binding protein inhibitor ID-4 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:P47928-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "ID4/iso:1" EXACT PRO-short-label [] is_a: PR:000000042 ! DNA-binding protein inhibitor ID-4 [Term] id: PR:000000176 name: GTP-binding protein RhoA def: "A rho-related small GTPase that is a translation product of the RHOA gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "RHOA" EXACT PRO-short-label [] synonym: "h12" EXACT [] synonym: "rho cDNA clone 12" EXACT [] synonym: "ARH12" RELATED [] synonym: "ARHA" RELATED [] synonym: "Arha2" RELATED [] synonym: "RHO12" RELATED [] is_a: PR:000000122 ! rho-related small GTPase [Term] id: PR:000000177 name: RING-box protein 1 isoform 1 def: "A RING-box protein 1 that is a translation product of a mature transcript of the RBX1 gene, comprising the core domains. Represented by the sequence UniProtKB:P62877-1." [PRO:CNA] comment: Category=sequence. synonym: "RBX1/iso:1" EXACT PRO-short-label [] is_a: PR:000000043 ! RING-box protein 1 [Term] id: PR:000000178 name: RING-box protein 2 isoform 1 def: "A RING-box protein 2 that is a translation product of a mature transcript of the RNF7 gene, comprising the core domains. Represented by the sequence UniProtKB:Q9UBF6-1." [PRO:CNA] comment: Category=sequence. synonym: "RNF7/iso:1" EXACT PRO-short-label [] is_a: PR:000000044 ! RING-box protein 2 [Term] id: PR:000000179 name: RING-box protein 2 isoform 2 def: "A RING-box protein 2 that is a translation product of a mature transcript of the RNF7 gene, that lacks the RING-finger domain because it has an alternative exon 2. Represented by the sequence UniProtKB:Q9UBF6-2." [PMID:11506706] comment: Category=sequence. synonym: "RNF7/iso:2" EXACT PRO-short-label [] synonym: "SAG-v" RELATED [] is_a: PR:000000044 ! RING-box protein 2 [Term] id: PR:000000180 name: S-phase kinase-associated protein 1A isoform 1 def: "A S-phase kinase-associated protein 1A that is a translation product of a mature transcript of the SKP1 gene including the five coding exons. Represented by the sequence UniProtKB:P63208-1." [PRO:CNA] comment: Category=sequence. synonym: "SKP1/iso:1" EXACT PRO-short-label [] is_a: PR:000000045 ! S-phase kinase-associated protein 1A [Term] id: PR:000000181 name: S-phase kinase-associated protein 1A isoform 2 def: "A S-phase kinase-associated protein 1A 1 that is a translation product of a mature transcript of the SKP1 gene lacking the most 3' coding exon. Represented by the sequence UniProtKB:P63208-2." [PRO:CNA] comment: Category=sequence. synonym: "SKP1/iso:2" EXACT PRO-short-label [] is_a: PR:000000045 ! S-phase kinase-associated protein 1A [Term] id: PR:000000182 name: TGF-beta 1 def: "A TGF-beta that is a translation product of the TGFB1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "TGFB1" EXACT PRO-short-label [] synonym: "TGF-beta-1" EXACT [] synonym: "TGFB" RELATED [] xref: PANTHER:PTHR11848\:SF32 is_a: PR:000000046 ! TGF-beta [Term] id: PR:000000183 name: TGF-beta 2 def: "A TGF-beta that is a translation product of the TGFB2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "TGFB2" EXACT PRO-short-label [] synonym: "BSC-1 cell growth inhibitor" EXACT [] synonym: "cetermin" EXACT [] synonym: "G-TSF" EXACT [] synonym: "glioblastoma-derived T-cell suppressor factor" EXACT [] synonym: "polyergin" EXACT [] synonym: "TGF-beta-2" EXACT [] xref: PANTHER:PTHR11848\:SF33 is_a: PR:000000046 ! TGF-beta [Term] id: PR:000000184 name: TGF-beta 3 def: "A TGF-beta that is a translation product of the TGFB3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "TGFB3" EXACT PRO-short-label [] synonym: "TGF-beta-3" EXACT [] xref: PANTHER:PTHR11848\:SF34 is_a: PR:000000046 ! TGF-beta [Term] id: PR:000000185 name: TGF-beta receptor type-1 isoform 1 def: "A TGF-beta receptor type-1 that is a translation product of a mature transcript of the TGFBR1 gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. Represented by the sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. synonym: "TGFBR1/iso:1" EXACT PRO-short-label [] is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000186 name: TGF-beta receptor type-1 sequence variant 1 def: "A TGF-beta receptor type-1 that has an Ile residue at the position equivalent to Thr-200 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000187 name: TGF-beta receptor type-1 sequence variant 10 def: "A TGF-beta receptor type-1 that has an insertion of an Ala residue at the position equivalent to Ala-26 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. synonym: "TGFBR1*10A" RELATED [] is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000188 name: TGF-beta receptor type-1 sequence variant 11 def: "A TGF-beta receptor type-1 that has an amino acid deletion at the position equivalent to region 24-26 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. synonym: "TGFBR1*6A" RELATED [] is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000189 name: TGF-beta receptor type-1 sequence variant 2 def: "A TGF-beta receptor type-1 that has a Glu residue at the position equivalent to Lys-232 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000190 name: TGF-beta receptor type-1 sequence variant 3 def: "A TGF-beta receptor type-1 that has a Leu residue at the position equivalent to Ser-241 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000191 name: TGF-beta receptor type-1 sequence variant 4 def: "A TGF-beta receptor type-1 that has a His residue at the position equivalent to Asn-267 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000192 name: TGF-beta receptor type-1 sequence variant 5 def: "A TGF-beta receptor type-1 that has an Arg residue at the position equivalent to Met-318 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000193 name: TGF-beta receptor type-1 sequence variant 6 def: "A TGF-beta receptor type-1 that has a Gly residue at the position equivalent to Asp-400 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000194 name: TGF-beta receptor type-1 sequence variant 7 def: "A TGF-beta receptor type-1 that has a Pro residue at the position equivalent to Arg-487 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000195 name: TGF-beta receptor type-1 sequence variant 8 def: "A TGF-beta receptor type-1 that has a Glu residue at the position equivalent to Arg-487 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000196 name: TGF-beta receptor type-1 sequence variant 9 def: "A TGF-beta receptor type-1 that has a Trp residue at the position equivalent to Arg-487 in the human sequence UniProtKB:P36897-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000047 ! TGF-beta receptor type-1 [Term] id: PR:000000197 name: TGF-beta receptor type-2 isoform 1 cleaved form def: "A TGF-beta receptor type-2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025412 that derives_from PR:000000048. is_obsolete: true consider: PR:000025412 [Term] id: PR:000000198 name: TGF-beta receptor type-2 isoform 1 phosphorylated form def: "A TGFBR2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000048 ! TGF-beta receptor type-2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000199 name: activin receptor type-1 isoform 1 def: "An activin receptor type-1 that is a translation product of a mature transcript of the ACVR1 gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. Represented by the sequence UniProtKB:Q04771-1." [PRO:CNA] comment: Category=sequence. synonym: "ACVR1/iso:1" EXACT PRO-short-label [] is_a: PR:000000067 ! activin receptor type-1 [Term] id: PR:000000200 name: activin receptor type-1 sequence variant 1 def: "An activin receptor type-1 that has a His residue in the GS-motif at the position equivalent to amino acid Arg-206 in human sequence UniProtKB:Q04771-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000067 ! activin receptor type-1 [Term] id: PR:000000201 name: activin receptor type-1B isoform 1 def: "An activin receptor type-1B that is a translation product of a mature transcript of the ACVR1B gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. Represented by the sequence UniProtKB:P36896-1." [PRO:CNA] comment: Category=sequence. synonym: "ACVR1B/iso:1" EXACT PRO-short-label [] synonym: "Alk4-1" RELATED [] synonym: "SKR2-1" RELATED [] is_a: PR:000000068 ! activin receptor type-1B [Term] id: PR:000000202 name: activin receptor type-1B isoform 2 def: "An activin receptor type-1B that is a translation product of a mature transcript of the ACVR1B gene that contains an alternative exon 10 (10b) and lacks exon 11, as compared to isoform 1 (PR:000000201), rendering an receptor with a truncated kinase domain and a unique C-terminal tail. Represented by the sequence UniProtKB:P36896-2. Predominantly expressed in pituitary adenomas." [PMID:11117535, PRO:CNA] comment: Category=sequence. synonym: "ACVR1B/iso:2" EXACT PRO-short-label [] synonym: "Alk4-2" RELATED [] synonym: "SKR2-2" RELATED [] is_a: PR:000000068 ! activin receptor type-1B [Term] id: PR:000000203 name: activin receptor type-1B isoform 3 def: "An activin receptor type-1B that is a translation product of a mature transcript of the ACVR1B gene that contains an alternative exon 9 (9b) and lacks exons 10 and 11, as compared to isoform 1 (PR:000000201), rendering an receptor with a truncated kinase domain and a unique C-terminal tail. Represented by the sequence UniProtKB:P36896-3. Predominantly expressed in pituitary adenomas." [PMID:11117535, PRO:CNA] comment: Category=sequence. synonym: "ACVR1B/iso:3" EXACT PRO-short-label [] synonym: "Alk4-3" RELATED [] synonym: "SKR2-3" RELATED [] is_a: PR:000000068 ! activin receptor type-1B [Term] id: PR:000000204 name: activin receptor type-1C isoform 1 def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS-motif and protein kinase domain. Represented by the sequence UniProtKB:Q8NER5-1." [PRO:CNA] comment: Category=sequence. synonym: "ACVR1C/iso:1" EXACT PRO-short-label [] is_a: PR:000000069 ! activin receptor type-1C [Term] id: PR:000000205 name: activin receptor type-1C isoform 2 def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that lacks the transmembrane domain. Represented by the sequence UniProtKB:Q8NER5-2." [PMID:12606401, PRO:CNA] comment: Category=sequence. synonym: "ACVR1C/iso:2" EXACT PRO-short-label [] synonym: "Isoform A" RELATED [] is_a: PR:000000069 ! activin receptor type-1C [Term] id: PR:000000206 name: activin receptor type-1C isoform 3 def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that lacks the transmembrane domain. Represented by the sequence UniProtKB:Q8NER5-3." [PMID:12606401, PRO:CNA] comment: Category=sequence. synonym: "ACVR1C/iso:3" EXACT PRO-short-label [] synonym: "Isoform B" RELATED [] is_a: PR:000000069 ! activin receptor type-1C [Term] id: PR:000000207 name: activin receptor type-1C isoform 4 def: "An activin receptor type-1C that is a translation product of a mature transcript of the ACVR1C gene, and that has a partial deletion of the extracellular activin types I and II receptor domain. Represented by the sequence UniProtKB:Q8NER5-4." [PMID:12606401, PRO:CNA] comment: Category=sequence. synonym: "ACVR1C/iso:4" EXACT PRO-short-label [] is_a: PR:000000069 ! activin receptor type-1C [Term] id: PR:000000208 name: activin receptor type-2A isoform 1 def: "An activin receptor type-2A that is a translation product of a mature transcript of the ACVR2A gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular protein kinase domain. Represented by the sequence UniProtKB:P27038-1." [PMID:8395525] comment: Category=sequence. synonym: "ACVR2A/iso:1" EXACT PRO-short-label [] is_a: PR:000000070 ! activin receptor type-2A [Term] id: PR:000000209 name: activin receptor type-2B isoform 1 def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, and that contains the cluster of proline residues in the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), but lacks the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain. Represented by the sequence UniProtKB:Q13705-1." [PRO:CNA] comment: Category=sequence. synonym: "ACVR2B/iso:1" EXACT PRO-short-label [] synonym: "ActR-IIB2" RELATED [] is_a: PR:000000071 ! activin receptor type-2B [Term] id: PR:000000210 name: activin receptor type-2B isoform 2 def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, and that contains the cluster of proline residues in the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), and the intracellular segment (known as splicing cassette II) with an insertion and frameshift that leads to protein truncation. This form may have dominant-negative properties. Represented by the sequence UniProtKB:Q13705-2." [PMID:9916847] comment: Category=sequence. synonym: "ACVR2B/iso:2" EXACT PRO-short-label [] synonym: "ActR-IIB1" RELATED [] is_a: PR:000000071 ! activin receptor type-2B [Term] id: PR:000000211 name: activin receptor type-2B isoform 3 def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, and that contains the cluster of proline residues of the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), and the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain. Represented by the sequence UniProtKB:P27040-1." [PMID:1310075, PRO:CNA] comment: Category=sequence. synonym: "ACVR2B/iso:3" EXACT PRO-short-label [] is_a: PR:000000071 ! activin receptor type-2B [Term] id: PR:000000212 name: activin receptor type-2B isoform 4 def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, that lacks the cluster of proline residues of the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), but includes the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain. Represented by the sequence UniProtKB:P27040-3." [PRO:CNA] comment: Category=sequence. synonym: "ACVR2B/iso:4" EXACT PRO-short-label [] is_a: PR:000000071 ! activin receptor type-2B [Term] id: PR:000000213 name: activin receptor type-2B isoform 5 def: "An activin receptor type-2B that is a translation product of a mature transcript of the ACVR2B gene, that lacks both the cluster of proline residues of the extracellular domain located immediately before the transmembrane region (known as splicing cassette I), and the intracellular segment rich in basic and acidic residues (known as splicing cassette II), located preceding a proline-rich sequence between the transmembrane region and the kinase domain. Represented by the sequence UniProtKB:P27040-4." [PRO:CNA] comment: Category=sequence. synonym: "ACVR2B/iso:5" EXACT PRO-short-label [] is_a: PR:000000071 ! activin receptor type-2B [Term] id: PR:000000214 name: activin receptor type-2B sequence variant 1 def: "An activin receptor type-2B that has a His residue at the position equivalent to Arg-40 of the extracellular domain in the human sequence UniProtKB:Q13705-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000071 ! activin receptor type-2B [Term] id: PR:000000215 name: activin receptor type-2B sequence variant 2 def: "An activin receptor type-2B that has an Ile residue at the position equivalent to Val-494 in the human sequence UniProtKB:Q13705-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000071 ! activin receptor type-2B [Term] id: PR:000000216 name: activin/inhibin beta A chain def: "An activin/inhibin beta subunit that is a translation product of the INHBA gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "INHBA" EXACT PRO-short-label [] synonym: "activin beta-A chain" EXACT [] synonym: "EDF" EXACT [] synonym: "erythroid differentiation protein" EXACT [] xref: PANTHER:PTHR11848\:SF28 is_a: PR:000000072 ! activin/inhibin beta subunit [Term] id: PR:000000217 name: activin/inhibin beta B chain def: "An activin/inhibin beta subunit that is a translation product of the INHBB gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "INHBB" EXACT PRO-short-label [] synonym: "activin beta-B chain" EXACT [] xref: PANTHER:PTHR11848\:SF29 is_a: PR:000000072 ! activin/inhibin beta subunit [Term] id: PR:000000218 name: activin/inhibin beta C chain def: "An activin/inhibin beta subunit that is a translation product of the INHBC gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "INHBC" EXACT PRO-short-label [] synonym: "activin beta-C chain" EXACT [] xref: PANTHER:PTHR11848\:SF26 is_a: PR:000000072 ! activin/inhibin beta subunit [Term] id: PR:000000219 name: activin/inhibin beta E chain def: "An activin/inhibin beta subunit that is a translation product of the INHBE gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "INHBE" EXACT PRO-short-label [] synonym: "activin beta-E chain" EXACT [] xref: PANTHER:PTHR11848\:SF6 is_a: PR:000000072 ! activin/inhibin beta subunit [Term] id: PR:000000220 name: anti-Muellerian hormone isoform 1 def: "An anti-Muellerian hormone that is a translation product of a mature transcript of the AMH gene, and that contains a signal peptide, anti-Mullerian hormone N-terminal domain and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P27106-1. This form is the precursor." [PRO:CNA] comment: Category=sequence. synonym: "AMH/iso:1" EXACT PRO-short-label [] synonym: "AMH" RELATED [] is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000221 name: anti-Muellerian hormone sequence variant 1 def: "An anti-Muellerian hormone that has a Gly residue at the position equivalent to Val-12 in the human sequence UniProtKB:P03971-1 that is part of the signal peptide." [PRO:CNA] comment: Category=sequence. is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000222 name: anti-Muellerian hormone sequence variant 2 def: "An anti-Muellerian hormone that has a Pro residue at the position equivalent to Leu-70 in the human sequence UniProtKB:P03971-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000223 name: anti-Muellerian hormone sequence variant 3 def: "An anti-Muellerian hormone that has a Val residue at the position equivalent to Gly-101 in the human sequence UniProtKB:P03971-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000224 name: anti-Muellerian hormone sequence variant 4 def: "An anti-Muellerian hormone that has a Trp residue at the position equivalent to Arg-123 in the human sequence UniProtKB:P03971-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000225 name: anti-Muellerian hormone sequence variant 5 def: "An anti-Muellerian hormone that has a Cys residue at the position equivalent to Tyr-167 in the human sequence UniProtKB:P03971-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000226 name: anti-Muellerian hormone sequence variant 6 def: "An anti-Muellerian hormone that has a Cys residue at the position equivalent to Arg-194 in the human sequence UniProtKB:P03971-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000227 name: anti-Muellerian hormone sequence variant 7 def: "An anti-Muellerian hormone that has an Ala residue at the position equivalent to Val-477 in the human sequence UniProtKB:P03971-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000073 ! anti-Muellerian hormone [Term] id: PR:000000228 name: c-myc protein isoform 1 def: "A c-myc protein that is a translation product of a mature transcript of the MYC gene comprising the first ATG-initiated open reading frame extending from exon 2 through exon 3. Represented by the sequence UniProtKB:P01106-1." [PMID:3277717] comment: Category=sequence. synonym: "MYC/iso:1" EXACT PRO-short-label [] is_a: PR:000000084 ! c-myc protein [Term] id: PR:000000229 name: c-myc protein isoform 2 def: "A c-myc protein that is a translation product of a mature transcript of the MYC gene using an alternate non-ATG initiator in exon 1, rendering an N-terminal extended form. Represented by the sequence UniProtKB:P01106-2." [PMID:3277717] comment: Category=sequence. synonym: "MYC/iso:2" EXACT PRO-short-label [] synonym: "p67" RELATED [] synonym: "p68" RELATED [] is_a: PR:000000084 ! c-myc protein [Term] id: PR:000000230 name: cartilage oligomeric matrix protein isoform 1 def: "A cartilage oligomeric matrix protein that is a translation product of a mature transcript of the COMP gene, comprising all core domains. Represented by the sequence UniProtKB:P49747-1, and is the precursor of the mature protein." [PRO:CNA] comment: Category=sequence. synonym: "COMP/iso:1" EXACT PRO-short-label [] synonym: "precursor" RELATED [] is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000231 name: cartilage oligomeric matrix protein sequence variant 1 def: "A cartilage oligomeric matrix protein that has an Arg residue at the position equivalent to Pro-276 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000232 name: cartilage oligomeric matrix protein sequence variant 10 def: "A cartilage oligomeric matrix protein that has a Gly residue at the position equivalent to Cys-387 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000233 name: cartilage oligomeric matrix protein sequence variant 11 def: "A cartilage oligomeric matrix protein that has a Tyr residue at the position equivalent to Asp-408 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000234 name: cartilage oligomeric matrix protein sequence variant 12 def: "A cartilage oligomeric matrix protein that has an Ala residue at the position equivalent to Asp-420 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000235 name: cartilage oligomeric matrix protein sequence variant 13 def: "A cartilage oligomeric matrix protein that has a Glu residue at the position equivalent to Gly-440 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000236 name: cartilage oligomeric matrix protein sequence variant 14 def: "A cartilage oligomeric matrix protein that has an Arg residue at the position equivalent to Gly-440 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000237 name: cartilage oligomeric matrix protein sequence variant 15 def: "A cartilage oligomeric matrix protein that has a Ser residue at the position equivalent to Asn-453 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000238 name: cartilage oligomeric matrix protein sequence variant 16 def: "A cartilage oligomeric matrix protein that has a Val residue at the position equivalent to Asp-439 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000239 name: cartilage oligomeric matrix protein sequence variant 17 def: "A cartilage oligomeric matrix protein that has a Tyr residue at the position equivalent to Cys-468 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000240 name: cartilage oligomeric matrix protein sequence variant 18 def: "A cartilage oligomeric matrix protein that has a Tyr residue at the position equivalent to Asp-472 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000241 name: cartilage oligomeric matrix protein sequence variant 19 def: "A cartilage oligomeric matrix protein that has a Gly residue at the position equivalent to Asp-473 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000242 name: cartilage oligomeric matrix protein sequence variant 2 def: "A cartilage oligomeric matrix protein that has an Asn residue at the position equivalent to Asp-290 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000243 name: cartilage oligomeric matrix protein sequence variant 20 def: "A cartilage oligomeric matrix protein that has a Gly residue at the position equivalent to Asp-482 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000244 name: cartilage oligomeric matrix protein sequence variant 21 def: "A cartilage oligomeric matrix protein that has an Asn residue at the position equivalent to asp-518 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000245 name: cartilage oligomeric matrix protein sequence variant 22 def: "A cartilage oligomeric matrix protein that has an Asp residue at the position equivalent to Gly-719 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000246 name: cartilage oligomeric matrix protein sequence variant 23 def: "A cartilage oligomeric matrix protein that has a Lys residue at the position equivalent to Asn-523 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000247 name: cartilage oligomeric matrix protein sequence variant 24 def: "A cartilage oligomeric matrix protein that has a Met residue at the position equivalent to Thr-585 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000248 name: cartilage oligomeric matrix protein sequence variant 25 def: "A cartilage oligomeric matrix protein that has an Arg residue at the position equivalent to Thr-585 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000249 name: cartilage oligomeric matrix protein sequence variant 26 def: "A cartilage oligomeric matrix protein that has a Val residue at the position equivalent to region 391-394 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000250 name: cartilage oligomeric matrix protein sequence variant 27 def: "A cartilage oligomeric matrix protein that has an amino acid deletion at the position equivalent to residue 372 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000251 name: cartilage oligomeric matrix protein sequence variant 28 def: "A cartilage oligomeric matrix protein that has an amino acid deletion at the position equivalent to residue 374 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000252 name: cartilage oligomeric matrix protein sequence variant 29 def: "A cartilage oligomeric matrix protein that has an amino acid deletion at the position equivalent to residue 459 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000253 name: cartilage oligomeric matrix protein sequence variant 3 def: "A cartilage oligomeric matrix protein that has an Arg residue at the position equivalent to Gly-299 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000254 name: cartilage oligomeric matrix protein sequence variant 30 def: "A cartilage oligomeric matrix protein that has an amino acid deletion at the position equivalent to residue 469 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000255 name: cartilage oligomeric matrix protein sequence variant 31 def: "A cartilage oligomeric matrix protein that has an amino acid deletion at the position equivalent to residue 473 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000256 name: cartilage oligomeric matrix protein sequence variant 32 def: "A cartilage oligomeric matrix protein that has an amino acid deletion at the position equivalent to region 367-368 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000257 name: cartilage oligomeric matrix protein sequence variant 33 def: "A cartilage oligomeric matrix protein that has an amino acid deletion at the position equivalent to region 513-516 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000258 name: cartilage oligomeric matrix protein sequence variant 4 def: "A cartilage oligomeric matrix protein that has an Arg residue at the position equivalent to Cys-328 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000259 name: cartilage oligomeric matrix protein sequence variant 5 def: "A cartilage oligomeric matrix protein that has a Tyr residue at the position equivalent to Asp-342 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000260 name: cartilage oligomeric matrix protein sequence variant 6 def: "A cartilage oligomeric matrix protein that has an Arg residue at the position equivalent to Cys-348 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000261 name: cartilage oligomeric matrix protein sequence variant 7 def: "A cartilage oligomeric matrix protein that has a Val residue at the position equivalent to Asp-361 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000262 name: cartilage oligomeric matrix protein sequence variant 8 def: "A cartilage oligomeric matrix protein that has a Tyr residue at the position equivalent to Asp-361 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000263 name: cartilage oligomeric matrix protein sequence variant 9 def: "A cartilage oligomeric matrix protein that has a Ser residue at the position equivalent to Cys-371 in the human sequence UniProtKB:P49747-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000085 ! cartilage oligomeric matrix protein [Term] id: PR:000000264 name: chordin isoform 1 cleaved form def: "A chordin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025419 that derives_from PR:000000086. is_obsolete: true consider: PR:000025419 [Term] id: PR:000000265 name: creb-binding protein isoform 1 def: "A creb-binding protein that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q92793-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "CREBBP/iso:1" EXACT PRO-short-label [] is_a: PR:000000090 ! creb-binding protein [Term] id: PR:000000266 name: creb-binding protein sequence variant 1 def: "A creb-binding protein that has an Arg residue at the position equivalent to Pro-1378 in the human sequence UniProtKB:Q92793-1." [PMID:11331617] comment: Category=sequence. is_a: PR:000000090 ! creb-binding protein [Term] id: PR:000000267 name: cullin-1 isoform 1 def: "A cullin-1 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q13616-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "CUL1/iso:1" EXACT PRO-short-label [] is_a: PR:000000092 ! cullin-1 [Term] id: PR:000000268 name: cyclin-dependent kinase 4 inhibitor B isoform 1 def: "A cyclin-dependent kinase 4 inhibitor B that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:P42772-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "CDKN2B/iso:1" EXACT PRO-short-label [] is_a: PR:000000093 ! cyclin-dependent kinase 4 inhibitor B [Term] id: PR:000000269 name: cyclin-dependent kinase 4 inhibitor B sequence variant 1 def: "A cyclin-dependent kinase 4 inhibitor B that has a Glu residue at the position equivalent to Gly-47 in human sequence UniProtKB:P42772-1, and is involved in lung adenocarcinoma." [PMID:7882351] comment: Category=sequence. is_a: PR:000000093 ! cyclin-dependent kinase 4 inhibitor B [Term] id: PR:000000270 name: cyclin-dependent kinase 4 inhibitor B sequence variant 2 def: "A cyclin-dependent kinase 4 inhibitor B that has a Val residue at the position equivalent to Ala-50 in human sequence UniProtKB:P42772-1, and is involved in lung adenocarcinoma." [PMID:7882351] comment: Category=sequence. is_a: PR:000000093 ! cyclin-dependent kinase 4 inhibitor B [Term] id: PR:000000271 name: decorin isoform 1 def: "A decorin that is a translation product of a mature transcript of the DCN gene comprising all coding exons. Represented by the sequence UniProtKB:P07585-1." [PRO:CNA] comment: Category=sequence. synonym: "DCN/iso:1" EXACT PRO-short-label [] synonym: "isoform A precursor" RELATED [] is_a: PR:000000094 ! decorin [Term] id: PR:000000272 name: decorin isoform 2 def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 3 and 4 in the coding region compared to isoform 1. Represented by the sequence UniProtKB:P07585-2. This does not cause frameshift but the encoded lacks a strech of approximately 100 amino acids after the propeptide region. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634] comment: Category=sequence. synonym: "DCN/iso:2" EXACT PRO-short-label [] synonym: "isoformB" RELATED [] is_a: PR:000000094 ! decorin [Term] id: PR:000000273 name: decorin isoform 3 def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 3, 4 and 5 in the coding region compared to isoform 1. This causes an internal frameshift and the encoded isoform is shorter. Represented by the sequence UniProtKB:P07585-3. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634] comment: Category=sequence. synonym: "DCN/iso:3" EXACT PRO-short-label [] synonym: "isoformC" RELATED [] is_a: PR:000000094 ! decorin [Term] id: PR:000000274 name: decorin isoform 4 def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 4, 5, 6 and 7 in the coding region compared to isoform 1. This does not cause a frameshift but the encoded isoform lacks a strech of approximately 187 amino acids. Represented by the sequence UniProtKB:P07585-4. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634] comment: Category=sequence. synonym: "DCN/iso:4" EXACT PRO-short-label [] synonym: "isoformD" RELATED [] is_a: PR:000000094 ! decorin [Term] id: PR:000000275 name: decorin isoform 5 def: "A decorin that is a translation product of a mature transcript of the DCN gene that lacks exons 3, 4, 5, 6 and 7 in the coding region compared to isoform 1. This causes a frameshift and the encoded isoform is shorter. Represented by the sequence UniProtKB:P07585-5. Thus it is not clear if cleavage takes place for the mature peptide to be produced from the proprotein." [EntrezGene:1634] comment: Category=sequence. synonym: "DCN/iso:5" EXACT PRO-short-label [] synonym: "isoformE" RELATED [] is_a: PR:000000094 ! decorin [Term] id: PR:000000276 name: fas ligand, TNF-like isoform 1 def: "A fas ligand that is a translation product of a mature transcript of the FASLG gene comprising the exons that code for the cytoplasmic, the transmembrane and the TNF (extracellular) domains. Represented by the sequence UniProtKB:P48023-1." [PRO:CNA] comment: Category=sequence. synonym: "FASLG/iso:1" EXACT PRO-short-label [] synonym: "FasL long" RELATED [] is_a: PR:000000095 ! fas ligand, TNF-like [Term] id: PR:000000277 name: fas ligand, TNF-like isoform 2 def: "A fas ligand that is a translation product of a mature transcript of the FASLG gene that lacks the exons coding for the transmembrane domain. Represented by the sequence UniProtKB:P41047-2." [PMID:10552956, PRO:CNA] comment: Category=sequence. synonym: "FASLG/iso:2" EXACT PRO-short-label [] synonym: "FasL short" RELATED [] synonym: "FasLS" RELATED [] is_a: PR:000000095 ! fas ligand, TNF-like [Term] id: PR:000000278 name: fas ligand sequence variant 1 def: "A fas ligand that has a Leu residue at the position equivalent to Phe-273 in the mouse sequence UniProtKB:P41047-1 which leads to an immune system phenotype with enlarged lymph nodes (MP:0000702) and increased lymphocyte cell number (MP:0005013)." [PMID:7495745, PRO:CNA] comment: Category=sequence. synonym: "gld" RELATED [] is_a: PR:000000095 ! fas ligand, TNF-like [Term] id: PR:000000279 name: follistatin isoform 1, signal peptide removed cleaved and glycosylated form def: "A follistatin proteolytic cleavage product derived from follistatin isoform 1, signal peptide removed form that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "follistatin isoform 1 cleaved and glycosylated form" EXACT [] intersection_of: PR:000025457 ! follistatin proteolytic cleavage product intersection_of: derives_from PR:000025461 ! follistatin isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000280 name: follistatin isoform 2, signal peptide removed cleaved and glycosylated form def: "A follistatin proteolytic cleavage product derived from follistatin isoform 2, signal peptide removed form that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "follistatin isoform 2 cleaved and glycosylated form" EXACT [] intersection_of: PR:000025457 ! follistatin proteolytic cleavage product intersection_of: derives_from PR:000025462 ! follistatin isoform 2, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000281 name: growth/differentiation factor 5 def: "A growth/differentiation factor that is a translation product of the GDF5 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "GDF5" EXACT PRO-short-label [] synonym: "cartilage-derived morphogenetic protein 1" EXACT [] synonym: "CDMP-1" EXACT [] synonym: "GDF-5" EXACT [] synonym: "radotermin" EXACT [] synonym: "Bp" RELATED [] synonym: "CDMP1" RELATED [] xref: PANTHER:PTHR11848\:SF44 is_a: PR:000000098 ! growth/differentiation factor [Term] id: PR:000000282 name: growth/differentiation factor 7 def: "A growth/differentiation factor that is a translation product of the GDF7 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "GDF7" EXACT PRO-short-label [] synonym: "GDF-7" EXACT [] xref: PANTHER:PTHR11848\:SF42 is_a: PR:000000098 ! growth/differentiation factor [Term] id: PR:000000283 name: interferon gamma isoform 1, signal peptide removed cleaved and glycosylated form def: "An interferon gamma proteolytic cleavage product that is derived from interferon gamma isoform 1, signal peptide removed form that has been processed by proteolytic cleavage and post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "interferon gamma isoform 1 cleaved and glycosylated form" EXACT [] intersection_of: PR:000018271 ! interferon gamma proteolytic cleavage product intersection_of: derives_from PR:000000445 ! interferon gamma isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000284 name: interferon gamma isoform 1 cleaved form def: "An interferon gamma isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018271 that derives_from PR:000000100. is_obsolete: true consider: PR:000018271 [Term] id: PR:000000285 name: latent TGF-beta-binding protein 1 isoform 1 def: "A latent TGF-beta-binding protein 1 that is a translation product of the longest mature transcript of LTBP1 gene, and that contains a unique N-terminus consisting of a signal peptide, a conserved Cys motif C(x)3CC(x)11C, and an EGF-like domain. The presence of multiple EGF-like domains, calcium binding EGF and TB domains at the C-terminus is common with other isoforms. This form is a precursor. Represented by the sequence UniProtKB:Q14766-1." [PMID:8537398, PRO:CNA] comment: Category=sequence. synonym: "LTBP1/iso:1" EXACT PRO-short-label [] synonym: "long isoform" RELATED [] is_a: PR:000000101 ! latent TGF-beta-binding protein 1 [Term] id: PR:000000286 name: latent TGF-beta-binding protein 1 isoform 2 def: "A latent TGF-beta-binding protein 1 that is a translation product of the short mature transcript of TGFB1 gene, and that contains a unique signal peptide, multiple EGF-like domains, and calcium binding EGF and TB domains at the C-terminus, that is common with other isoforms. This form is a precursor. Represented by the sequence UniProtKB:Q14766-2." [PMID:8537398, PRO:CNA] comment: Category=sequence. synonym: "LTBP1/iso:2" EXACT PRO-short-label [] synonym: "LTBP-1S precursor" RELATED [] synonym: "LTPBP1 short isoform" RELATED [] is_a: PR:000000101 ! latent TGF-beta-binding protein 1 [Term] id: PR:000000287 name: lefty 1 def: "A lefty that is a translation product of the LEFTY1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "LEFTY1" EXACT PRO-short-label [] synonym: "protein lefty-1" EXACT [] synonym: "stimulated by retinoic acid gene 3 protein" EXACT [] synonym: "Ebaf" RELATED [] synonym: "Left-right determination factor B" RELATED [DNx] synonym: "LEFTB" RELATED [] synonym: "Lefty" RELATED [] synonym: "LEFTYB" RELATED [] synonym: "protein lefty-B" RELATED [] synonym: "Stra3" RELATED [] synonym: "TGF-beta-4" RELATED [] synonym: "Tgfb4" RELATED [] synonym: "transforming growth factor beta-4" RELATED [] synonym: "lefty protein" BROAD [] is_a: PR:000000102 ! lefty protein [Term] id: PR:000000288 name: lefty 2 def: "A protein that is a translation product of the LEFTY2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "LEFTY2" EXACT PRO-short-label [] synonym: "endometrial bleeding-associated factor" EXACT [] synonym: "Left-right determination factor A" EXACT [DNx] synonym: "protein lefty-2" EXACT [] synonym: "protein lefty-A" EXACT [] synonym: "EBAF" RELATED [] synonym: "Left-right determination factor B" RELATED [DNx] synonym: "LEFTA" RELATED [] synonym: "Leftb" RELATED [] synonym: "LEFTYA" RELATED [] synonym: "protein lefty-B" RELATED [] synonym: "TGF-beta-4" RELATED [] synonym: "TGFB4" RELATED [] synonym: "transforming growth factor beta-4" RELATED [] is_a: PR:000000102 ! lefty protein [Term] id: PR:000000289 name: mitogen-activated protein kinase 1 isoform 1 def: "A mitogen-activated protein kinase 1 that is a translation product of a mature transcript of the MAPK1 gene, and that contains an intact protein kinase domain. Represented by the sequence UniProtKB:P28482-1." [PRO:CNA] comment: Category=sequence. synonym: "MAPK1/iso:1" EXACT PRO-short-label [] is_a: PR:000000103 ! mitogen-activated protein kinase 1 [Term] id: PR:000000290 name: mitogen-activated protein kinase 3 isoform 1 def: "A mitogen-activated protein kinase 3 that is a translation product of a mature transcript of the MAPK3 gene, and that contains an intact protein kinase domain. Represented by the sequence UniProtKB:P27361-1." [PRO:CNA] comment: Category=sequence. synonym: "MAPK3/iso:1" EXACT PRO-short-label [] is_a: PR:000000104 ! mitogen-activated protein kinase 3 [Term] id: PR:000000291 name: nodal protein isoform 1 def: "A nodal protein that is a translation product of a mature transcript of the NODAL gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:Q96S42-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "NODAL/iso:1" EXACT PRO-short-label [] synonym: "precursor" RELATED [] is_a: PR:000000105 ! nodal protein [Term] id: PR:000000292 name: nodal protein sequence variant 1 def: "A nodal protein that has a Gln residue at the position equivalent to Arg-183 in the human sequence UniProtKB:Q96S42-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000105 ! nodal protein [Term] id: PR:000000293 name: noggin isoform 1 cleaved form def: "A noggin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025434 that derives_from PR:000000106. is_obsolete: true consider: PR:000025434 [Term] id: PR:000000294 name: pituitary homeobox protein 2 isoform 1 def: "A translation product of a mature transcript of the PITX2 gene comprising exons 1-2, 5 and 6. Represented by the sequence UniProtKB:Q99697-3." [PMID:10585561] comment: Category=sequence. synonym: "PITX2/iso:1" EXACT PRO-short-label [] synonym: "ARP1A" EXACT [] synonym: "Pitx2a" EXACT [] is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000295 name: pituitary homeobox protein 2 isoform 2 def: "A translation product of a mature transcript of the PITX2 gene that includes exons 1-3, 5 and 6. Represented by the sequence UniProtKB:Q99697-1." [PMID:10585561] comment: Category=sequence. synonym: "PITX2/iso:2" EXACT PRO-short-label [] synonym: "ARP1B" RELATED [] synonym: "BRX1B" RELATED [] synonym: "Pitx2b" RELATED [] is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000296 name: pituitary homeobox protein 2 isoform 3 def: "A translation product of a mature transcript of the PITX2 gene that uses an alternative promoter located upstream of exon 4. Represented by the sequence UniProtKB:Q99697-2." [PMID:10585561] comment: Category=sequence. synonym: "PITX2/iso:3" EXACT PRO-short-label [] synonym: "ARP1C" RELATED [] synonym: "BRX1A" RELATED [] synonym: "Pitx2c" RELATED [] is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000297 name: pituitary homeobox protein 2 isoform 4 def: "A translation product of a mature transcript of the PITX2 gene that uses an alternative promoter and results from splicing of exon 4a to a cryptic 3'-splice site in exon 5, which produces a truncated homeodomain and complete C-terminal tail." [PMID:11948188, PRO:CNA] comment: Category=sequence. synonym: "PITX2/iso:4" EXACT PRO-short-label [] synonym: "pitx2D" RELATED [] is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000298 name: pituitary homeobox protein 2 sequence variant 1 def: "A pituitary homeobox protein 2 that has a Trp residue at the position equivalent to Arg-89 in the human sequence UniProtKB:Q99697-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000299 name: pituitary homeobox protein 2 sequence variant 2 def: "A pituitary homeobox protein 2 that has a Gln residue at the position equivalent to Leu-100 in the human sequence UniProtKB:Q99697-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000300 name: pituitary homeobox protein 2 sequence variant 3 def: "A pituitary homeobox protein 2 that has a Pro residue at the position equivalent to Thr-114 in the human sequence UniProtKB:Q99697-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000301 name: pituitary homeobox protein 2 sequence variant 4 def: "A pituitary homeobox protein 2 that has a His residue at the position equivalent to Arg-115 in the human sequence UniProtKB:Q99697-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000302 name: pituitary homeobox protein 2 sequence variant 5 def: "A pituitary homeobox protein 2 that has a Pro residue at the position equivalent to Arg-137 in the human sequence UniProtKB:Q99697-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000117 ! pituitary homeobox protein 2 [Term] id: PR:000000303 name: retinoblastoma-like protein 1 isoform 1 def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL1 gene, comprising the core domains. Represented by the sequence UniProtKB:P28749-1." [PRO:CNA] comment: Category=sequence. synonym: "RBL1/iso:1" EXACT PRO-short-label [] is_a: PR:000000118 ! retinoblastoma-like protein 1 [Term] id: PR:000000304 name: retinoblastoma-like protein 1 isoform 2 def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL1 gene, comprising the core domains. Represented by the sequence UniProtKB:P28749-2." [PRO:CNA] comment: Category=sequence. synonym: "RBL1/iso:2" EXACT PRO-short-label [] is_a: PR:000000118 ! retinoblastoma-like protein 1 [Term] id: PR:000000305 name: retinoblastoma-like protein 1 isoform 3 def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL1 gene, that lacks the C-terminal retinoblastoma-associated protein B domain. Represented by the sequence UniProtKB:Q64701-2." [PRO:CNA] comment: Category=sequence. synonym: "RBL1/iso:3" EXACT PRO-short-label [] is_a: PR:000000118 ! retinoblastoma-like protein 1 [Term] id: PR:000000306 name: retinoblastoma-like protein 2 isoform 1 def: "A retinoblastoma-like protein 1 that is a translation product of a mature transcript of the RBL2 gene, comprising the core domains. Represented by the sequence UniProtKB:Q08999-1." [PRO:CNA] comment: Category=sequence. synonym: "RBL2/iso:1" EXACT PRO-short-label [] is_a: PR:000000119 ! retinoblastoma-like protein 2 [Term] id: PR:000000307 name: rho-associated protein kinase 1 isoform 1 def: "A rho-associated protein kinase 1 that is a translation product of a mature transcript of the ROCK1 gene, comprising the core domains. In resting cells, the C-terminal Rho-binding and PH domain mask the protein kinase catalytic domain, activation occurs through a conformational change. Represented by the sequence UniProtKB:Q13464-1." [PRO:CNA] comment: Category=sequence. synonym: "ROCK1/iso:1" EXACT PRO-short-label [] synonym: "ROCK1 sequence 1" EXACT [] is_a: PR:000000120 ! rho-associated protein kinase 1 [Term] id: PR:000000308 name: rho-associated protein kinase 2 isoform 1 def: "A rho-associated protein kinase 1 that is a translation product of a mature transcript of the ROCK2 gene, comprising the core domains. In resting cells, the C-terminal Rho-binding and PH domain mask the protein kinase catalytic domain, activation occurs through a conformational change. Represented by the sequence UniProtKB:O75116-1." [PRO:CNA] comment: Category=sequence. synonym: "ROCK2/iso:1" EXACT PRO-short-label [] is_a: PR:000000121 ! rho-associated protein kinase 2 [Term] id: PR:000000309 name: rho-associated protein kinase 2 isoform 2 def: "A rho-associated protein kinase 1 that is a translation product of a mature transcript of the ROCK2 gene, comprising the core domains but with an inclusion of an extra exon (exon 27' in mouse) between the rho binding and the PH domains. Represented by the sequence UniProtKB:A5XDA7." [PRO:CNA] comment: Category=sequence. synonym: "ROCK2/iso:2" EXACT PRO-short-label [] synonym: "ROCK2M" RELATED [] is_a: PR:000000121 ! rho-associated protein kinase 2 [Term] id: PR:000000310 name: ribosomal protein S6 kinase beta-1 isoform 1 def: "A ribosomal protein S6 kinase beta-1 that is a translation product of a mature transcript of the RPS6KB1 gene, comprising the core domains. Represented by the sequence UniProtKB:P23443-1." [PRO:CNA] comment: Category=sequence. synonym: "RPS6KB1/iso:1" EXACT PRO-short-label [] synonym: "Alpha I" RELATED [] is_a: PR:000000123 ! ribosomal protein S6 kinase beta-1 [Term] id: PR:000000311 name: ribosomal protein S6 kinase beta-1 isoform 2 def: "A ribosomal protein S6 kinase beta-1 that is a translation product of a mature transcript of the RPS6KB1 gene, comprising the core domains. Represented by the sequence UniProtKB:P23443-2." [PRO:CNA] comment: Category=sequence. synonym: "RPS6KB1/iso:2" EXACT PRO-short-label [] synonym: "Alpha II" RELATED [] is_a: PR:000000123 ! ribosomal protein S6 kinase beta-1 [Term] id: PR:000000312 name: ribosomal protein S6 kinase beta-2 isoform 1 def: "A ribosomal protein S6 kinase beta-2 that is a translation product of a mature transcript of the RPS6KB2 gene, comprising the core domains. Represented by the sequence UniProtKB:Q9UBS0-1." [PRO:CNA] comment: Category=sequence. synonym: "RPS6KB2/iso:1" EXACT PRO-short-label [] is_a: PR:000000124 ! ribosomal protein S6 kinase beta-2 [Term] id: PR:000000313 name: sara isoform 1 def: "A sara that is a translation product of the longest mature transcript of ZFYVE9 gene, and that contains intact FYVE and smad-binding domains. Represented by the sequence UniProtKB:O95405-1." [PRO:CNA] comment: Category=sequence. synonym: "ZFYVE9/iso:1" EXACT PRO-short-label [] is_a: PR:000000125 ! sara [Term] id: PR:000000314 name: sara isoform 2 def: "A sara that is a translation product of a mature transcript of the ZFYVE9 gene which lacks an in-frame exon in the coding region as compared to isoform 1. Represented by the sequence UniProtKB:O95405-2." [PRO:CNA] comment: Category=sequence. synonym: "ZFYVE9/iso:2" EXACT PRO-short-label [] synonym: "NSP" RELATED [] is_a: PR:000000125 ! sara [Term] id: PR:000000315 name: sara isoform 3 def: "A sara that is a translation product of the mature transcript of ZFYVE9 gene, and lacks the smad-binding domain. Represented by the sequence UniProtKB:O95405-3." [PRO:CNA] comment: Category=sequence. synonym: "ZFYVE9/iso:3" EXACT PRO-short-label [] synonym: "NSP" RELATED [] is_a: PR:000000125 ! sara [Term] id: PR:000000316 name: serine/threonine-protein kinase receptor R3 isoform 1 def: "A serine/threonine-protein kinase receptor R3 that is a translation product of a mature transcript of the ACVRL1 gene, and that contains an extracellular activin types I and II receptor domain, a transmembrane domain, and an intracellular GS and protein kinase domains. Represented by the sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. synonym: "ACVRL1/iso:1" EXACT PRO-short-label [] synonym: "ALK1" RELATED [] synonym: "Serine/threonine-protein kinase receptor R3" RELATED [] is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000317 name: serine/threonine-protein kinase receptor R3 sequence variant 1 def: "A serine/threonine-protein kinase receptor R3 that has an Arg residue at the position equivalent to Gly-48 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000318 name: serine/threonine-protein kinase receptor R3 sequence variant 10 def: "A serine/threonine-protein kinase receptor R3 that has a Lys residue at the position equivalent to Glu-215 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000319 name: serine/threonine-protein kinase receptor R3 sequence variant 11 def: "A serine/threonine-protein kinase receptor R3 that has an amino acid deletion at the position equivalent to residue 222 in the human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000320 name: serine/threonine-protein kinase receptor R3 sequence variant 12 def: "A serine/threonine-protein kinase receptor R3 that has an amino acid deletion at the position equivalent to residue 233 in the human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000321 name: serine/threonine-protein kinase receptor R3 sequence variant 13 def: "A serine/threonine-protein kinase receptor R3 that has an Arg residue at the position equivalent to Gly-223 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000322 name: serine/threonine-protein kinase receptor R3 sequence variant 14 def: "A serine/threonine-protein kinase receptor R3 that has an Arg residue at the position equivalent to Lys-229 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000323 name: serine/threonine-protein kinase receptor R3 sequence variant 15 def: "A serine/threonine-protein kinase receptor R3 that has an amino acid deletion at the position equivalent to residue 254 in the human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000324 name: serine/threonine-protein kinase receptor R3 sequence variant 16 def: "A serine/threonine-protein kinase receptor R3 that has a Val residue at the position equivalent to Met-376 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000325 name: serine/threonine-protein kinase receptor R3 sequence variant 17 def: "A serine/threonine-protein kinase receptor R3 that has a Phe residue at the position equivalent to Leu-285 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000326 name: serine/threonine-protein kinase receptor R3 sequence variant 18 def: "A serine/threonine-protein kinase receptor R3 that has a Pro residue at the position equivalent to Ala-306 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000327 name: serine/threonine-protein kinase receptor R3 sequence variant 19 def: "A serine/threonine-protein kinase receptor R3 that has a Tyr residue at the position equivalent to His-314 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000328 name: serine/threonine-protein kinase receptor R3 sequence variant 2 def: "A serine/threonine-protein kinase receptor R3 that has a Cys residue at the position equivalent to Trp-50 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000329 name: serine/threonine-protein kinase receptor R3 sequence variant 20 def: "A serine/threonine-protein kinase receptor R3 that has an Ile residue at the position equivalent to Ser-333 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000330 name: serine/threonine-protein kinase receptor R3 sequence variant 21 def: "A serine/threonine-protein kinase receptor R3 that has a Pro residue at the position equivalent to Leu-337 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000331 name: serine/threonine-protein kinase receptor R3 sequence variant 22 def: "A serine/threonine-protein kinase receptor R3 that has a Tyr residue at the position equivalent to Cys-344 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000332 name: serine/threonine-protein kinase receptor R3 sequence variant 23 def: "A serine/threonine-protein kinase receptor R3 that has a Pro residue at the position equivalent to Ala-347 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000333 name: serine/threonine-protein kinase receptor R3 sequence variant 24 def: "A serine/threonine-protein kinase receptor R3 that has a Gln residue at the position equivalent to Arg-374 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000334 name: serine/threonine-protein kinase receptor R3 sequence variant 25 def: "A serine/threonine-protein kinase receptor R3 that has a Trp residue at the position equivalent to Arg-374 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000335 name: serine/threonine-protein kinase receptor R3 sequence variant 26 def: "A serine/threonine-protein kinase receptor R3 that has a Leu residue at the position equivalent to Pro-378 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000336 name: serine/threonine-protein kinase receptor R3 sequence variant 27 def: "A serine/threonine-protein kinase receptor R3 that has a Lys residue at the position equivalent to Glu-379 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000337 name: serine/threonine-protein kinase receptor R3 sequence variant 28 def: "A serine/threonine-protein kinase receptor R3 that has an Arg residue at the position equivalent to Met-376 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000338 name: serine/threonine-protein kinase receptor R3 sequence variant 29 def: "A serine/threonine-protein kinase receptor R3 that has a Gly residue at the position equivalent to Asp-397 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000339 name: serine/threonine-protein kinase receptor R3 sequence variant 3 def: "A serine/threonine-protein kinase receptor R3 that has a Tyr residue at the position equivalent to Cys-51 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000340 name: serine/threonine-protein kinase receptor R3 sequence variant 30 def: "A serine/threonine-protein kinase receptor R3 that has an Asn residue at the position equivalent to Ile-398 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000341 name: serine/threonine-protein kinase receptor R3 sequence variant 31 def: "A serine/threonine-protein kinase receptor R3 that has a Ser residue at the position equivalent to Trp-399 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000342 name: serine/threonine-protein kinase receptor R3 sequence variant 32 def: "A serine/threonine-protein kinase receptor R3 that has an Asp residue at the position equivalent to Glu-407 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000343 name: serine/threonine-protein kinase receptor R3 sequence variant 33 def: "A serine/threonine-protein kinase receptor R3 that has a Pro residue at the position equivalent to Arg-411 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000344 name: serine/threonine-protein kinase receptor R3 sequence variant 34 def: "A serine/threonine-protein kinase receptor R3 that has a Gln residue at the position equivalent to Arg-411 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000345 name: serine/threonine-protein kinase receptor R3 sequence variant 35 def: "A serine/threonine-protein kinase receptor R3 that has a Trp residue at the position equivalent to Arg-411 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000346 name: serine/threonine-protein kinase receptor R3 sequence variant 36 def: "A serine/threonine-protein kinase receptor R3 that has a Thr residue at the position equivalent to Pro-424 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000347 name: serine/threonine-protein kinase receptor R3 sequence variant 37 def: "A serine/threonine-protein kinase receptor R3 that has a Leu residue at the position equivalent to Phe-425 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000348 name: serine/threonine-protein kinase receptor R3 sequence variant 38 def: "A serine/threonine-protein kinase receptor R3 that has a Val residue at the position equivalent to Phe-425 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000349 name: serine/threonine-protein kinase receptor R3 sequence variant 39 def: "A serine/threonine-protein kinase receptor R3 that has an amino acid deletion at the position equivalent to residue 425 in the human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000350 name: serine/threonine-protein kinase receptor R3 sequence variant 4 def: "A serine/threonine-protein kinase receptor R3 that has a Gln residue at the position equivalent to Arg-67 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000351 name: serine/threonine-protein kinase receptor R3 sequence variant 40 def: "A serine/threonine-protein kinase receptor R3 that has a Leu residue at the position equivalent to Arg-479 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000352 name: serine/threonine-protein kinase receptor R3 sequence variant 41 def: "A serine/threonine-protein kinase receptor R3 that has a Val residue at the position equivalent to Ala-482 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000353 name: serine/threonine-protein kinase receptor R3 sequence variant 42 def: "A serine/threonine-protein kinase receptor R3 that has a Trp residue at the position equivalent to Arg-484 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000354 name: serine/threonine-protein kinase receptor R3 sequence variant 43 def: "A serine/threonine-protein kinase receptor R3 that has a Thr residue at the position equivalent to Lys-487 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000355 name: serine/threonine-protein kinase receptor R3 sequence variant 44 def: "A serine/threonine-protein kinase receptor R3 that has Glu-Pro residues at the position equivalent to Gly48-Ala49 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000356 name: serine/threonine-protein kinase receptor R3 sequence variant 5 def: "A serine/threonine-protein kinase receptor R3 that has a Trp residue at the position equivalent to Arg-67 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000357 name: serine/threonine-protein kinase receptor R3 sequence variant 6 def: "A serine/threonine-protein kinase receptor R3 that has a Trp residue at the position equivalent to Cys-77 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000358 name: serine/threonine-protein kinase receptor R3 sequence variant 7 def: "A serine/threonine-protein kinase receptor R3 that has an Asp residue at the position equivalent to Asn-96 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000359 name: serine/threonine-protein kinase receptor R3 sequence variant 8 def: "A serine/threonine-protein kinase receptor R3 that has an Ala residue at the position equivalent to Asp-179 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000360 name: serine/threonine-protein kinase receptor R3 sequence variant 9 def: "A serine/threonine-protein kinase receptor R3 that has an Asp residue at the position equivalent to Gly-211 in human sequence UniProtKB:P37023-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000126 ! serine/threonine-protein kinase receptor R3 [Term] id: PR:000000361 name: smad ubiquitination regulatory factor 1 def: "A smad ubiquitination regulatory factor that is a translation product of the SMURF1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "SMURF1" EXACT PRO-short-label [] synonym: "hSMURF1" EXACT [] synonym: "SMAD ubiquitination regulatory factor 1" EXACT [] synonym: "SMAD-specific E3 ubiquitin-protein ligase 1" EXACT [] synonym: "KIAA1625" RELATED [] is_a: PR:000000127 ! smad ubiquitination regulatory factor [Term] id: PR:000000362 name: smad ubiquitination regulatory factor 2 def: "A smad ubiquitination regulatory factor that is a translation product of the SMURF2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "SMURF2" EXACT PRO-short-label [] synonym: "hSMURF2" EXACT [] synonym: "SMAD ubiquitination regulatory factor 2" EXACT [] synonym: "SMAD-specific E3 ubiquitin-protein ligase 2" EXACT [] is_a: PR:000000127 ! smad ubiquitination regulatory factor [Term] id: PR:000000363 name: smad1 def: "A BMP receptor-regulated smad protein that is a translation product of the SMAD1 gene or a 1:1 ortholog thereof." [PMID:10708949, PRO:CNA] comment: Category=gene. synonym: "SMAD1" EXACT PRO-short-label [] synonym: "BSP-1" EXACT [] synonym: "dwarfin-A" EXACT [] synonym: "Dwf-A" EXACT [DNx] synonym: "hSMAD1" EXACT [] synonym: "JV4-1" EXACT [] synonym: "MAD homolog 1" EXACT [] synonym: "Mad-related protein 1" EXACT [DNx] synonym: "mMad1" EXACT [] synonym: "mothers against DPP homolog 1" EXACT [] synonym: "mothers-against-DPP-related 1" EXACT [] synonym: "SMAD 1" EXACT [] synonym: "SMAD family member 1" EXACT [] synonym: "transforming growth factor-beta-signaling protein 1" EXACT [] synonym: "BSP1" RELATED [] synonym: "MADH1" RELATED [] synonym: "MADR1" RELATED [] is_a: PR:000000038 ! BMP receptor-regulated smad protein [Term] id: PR:000000364 name: smad2 def: "A TGF-beta receptor-regulated smad protein that is a translation product of the SMAD2 gene or a 1:1 ortholog thereof." [PMID:9311995] comment: Category=gene. synonym: "SMAD2" EXACT PRO-short-label [] synonym: "hMAD-2" EXACT [] synonym: "hSMAD2" EXACT [] synonym: "JV18-1" EXACT [] synonym: "MAD homolog 2" EXACT [] synonym: "Mad-related protein 2" EXACT [DNx] synonym: "mMad2" EXACT [] synonym: "mothers against DPP homolog 2" EXACT [] synonym: "SMAD 2" EXACT [] synonym: "SMAD family member 2" EXACT [] synonym: "MADH2" RELATED [] synonym: "MADR2" RELATED [] is_a: PR:000000066 ! TGF-beta receptor-regulated smad protein [Term] id: PR:000000365 name: smad3 def: "A TGF-beta receptor-regulated smad protein that is a translation product of the SMAD3 gene or a 1:1 ortholog thereof." [PMID:9311995] comment: Category=gene. synonym: "SMAD3" EXACT PRO-short-label [] synonym: "hMAD-3" EXACT [] synonym: "hSMAD3" EXACT [] synonym: "JV15-2" EXACT [] synonym: "MAD homolog 3" EXACT [] synonym: "mad3" EXACT [] synonym: "mMad3" EXACT [] synonym: "mothers against DPP homolog 3" EXACT [] synonym: "SMAD 3" EXACT [] synonym: "SMAD family member 3" EXACT [] synonym: "MADH3" RELATED [] is_a: PR:000000066 ! TGF-beta receptor-regulated smad protein [Term] id: PR:000000366 name: smad4 isoform 1 def: "A smad4 that is a translation product of a mature transcript of the SMAD4 gene, and that contains the MH1 domain and the MH2 domain. Represented by the sequence UniProtKB:Q13485-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD4/iso:1" EXACT PRO-short-label [] is_a: PR:000000128 ! smad4 [Term] id: PR:000000367 name: smad4 sequence variant 1 def: "A smad4 that has a Gly residue at the position equivalent to Glu-330 in human sequence UniProtKB:Q13485-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000128 ! smad4 [Term] id: PR:000000368 name: smad4 sequence variant 2 def: "A smad4 that has an Arg residue at the position equivalent to Gly-352 in human sequence UniProtKB:Q13485-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000128 ! smad4 [Term] id: PR:000000369 name: smad4 sequence variant 3 def: "A smad4 that has a Cys residue at the position equivalent to Arg-361 in human sequence UniProtKB:Q13485-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000128 ! smad4 [Term] id: PR:000000370 name: smad4 sequence variant 4 def: "A smad4 that has an Asp residue at the position equivalent to Gly-386 in human sequence UniProtKB:Q13485-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000128 ! smad4 [Term] id: PR:000000371 name: smad4 sequence variant 5 def: "A smad4 that has a His residue at the position equivalent to Asp-493 in human sequence UniProtKB:Q13485-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000128 ! smad4 [Term] id: PR:000000372 name: smad5 def: "A BMP receptor-regulated smad protein that is a translation product of the SMAD5 gene or a 1:1 ortholog thereof." [PMID:10708949] comment: Category=gene. synonym: "SMAD5" EXACT PRO-short-label [] synonym: "dwarfin-C" EXACT [] synonym: "Dwf-C" EXACT [DNx] synonym: "hSmad5" EXACT [] synonym: "JV5-1" EXACT [] synonym: "MAD homolog 5" EXACT [] synonym: "mothers against DPP homolog 5" EXACT [] synonym: "mSmad5" EXACT [] synonym: "SMAD 5" EXACT [] synonym: "SMAD family member 5" EXACT [] synonym: "MADH5" RELATED [] is_a: PR:000000038 ! BMP receptor-regulated smad protein [Term] id: PR:000000373 name: smad6 def: "An inhibitory smad protein that is a translation product of the SMAD6 gene or a 1:1 ortholog thereof. Inhibitor of bone morphogenetic protein (BMP) signaling, and the interaction with BMP type 1 receptors is a critical step in the function of smad6." [PMID:17493940] comment: Category=gene. synonym: "SMAD6" EXACT PRO-short-label [] synonym: "hSMAD6" EXACT [] synonym: "MAD homolog 6" EXACT [] synonym: "Mad homolog 7" EXACT [DNx] synonym: "mothers against DPP homolog 6" EXACT [] synonym: "SMAD 6" EXACT [] synonym: "SMAD family member 6" EXACT [] synonym: "MADH6" RELATED [] synonym: "Madh7" RELATED [] synonym: "Msmad6" RELATED [] is_a: PR:000000099 ! inhibitory smad protein [Term] id: PR:000000374 name: smad7 def: "An inhibitory smad protein that is a translation product of the SMAD7 gene or a 1:1 ortholog thereof. Smad7 is a negative regulator of TGF-beta signaling." [PMID:17438144] comment: Category=gene. synonym: "SMAD7" EXACT PRO-short-label [] synonym: "hSMAD7" EXACT [] synonym: "MAD homolog 7" EXACT [] synonym: "MAD homolog 8" EXACT [] synonym: "mothers against decapentaplegic homolog 8" EXACT [] synonym: "mothers against DPP homolog 7" EXACT [] synonym: "mothers against DPP homolog 8" EXACT [] synonym: "SMAD 7" EXACT [] synonym: "SMAD family member 7" EXACT [] synonym: "MADH7" RELATED [] synonym: "MADH8" RELATED [] is_a: PR:000000099 ! inhibitory smad protein [Term] id: PR:000000375 name: smad9 def: "A BMP receptor-regulated smad protein that is a translation product of the SMAD9 gene or a 1:1 ortholog thereof." [PMID:10708948] comment: Category=gene. synonym: "SMAD9" EXACT PRO-short-label [] synonym: "MAD homolog 9" EXACT [] synonym: "Madh6" EXACT [DNx] synonym: "mothers against DPP homolog 9" EXACT [] synonym: "SMAD 9" EXACT [] synonym: "SMAD family member 9" EXACT [] synonym: "smad8" EXACT [] synonym: "Madh8" RELATED [] synonym: "MADH9" RELATED [] is_a: PR:000000038 ! BMP receptor-regulated smad protein [Term] id: PR:000000376 name: thrombospondin-1 isoform 1 def: "A thrombospondin-1 that is a translation product of a mature transcript of the THBS1 gene, comprising all core domains. Represented by the sequence UniProtKB:P07996-1. This form is the precursor of the mature protein." [PRO:CNA] comment: Category=sequence. synonym: "THBS1/iso:1" EXACT PRO-short-label [] is_a: PR:000000129 ! thrombospondin-1 [Term] id: PR:000000377 name: thrombospondin-2 isoform 1 def: "A thrombospondin-2 that is a translation product of a mature transcript of the THBS2 gene, comprising all core domains. Represented by the sequence UniProtKB:P35442-1. This form is the precursor of the mature protein." [PRO:CNA] comment: Category=sequence. synonym: "THBS2/iso:1" EXACT PRO-short-label [] is_a: PR:000000130 ! thrombospondin-2 [Term] id: PR:000000378 name: thrombospondin-3 isoform 1 def: "A thrombospondin-3 that is a translation product of a mature transcript of the THBS3 gene, comprising all core domains. Represented by the sequence UniProtKB:P49746-1. This form is the precursor of the mature protein." [PRO:CNA] comment: Category=sequence. synonym: "THBS3/iso:1" EXACT PRO-short-label [] is_a: PR:000000131 ! thrombospondin-3 [Term] id: PR:000000379 name: thrombospondin-4 isoform 1 def: "A thrombospondin-4 that is a translation product of a mature transcript of the THBS4 gene, comprising all core domains. Represented by the sequence UniProtKB:P35443-1. This form is the precursor of the mature protein." [PRO:CNA] comment: Category=sequence. synonym: "THBS4/iso:1" EXACT PRO-short-label [] is_a: PR:000000132 ! thrombospondin-4 [Term] id: PR:000000380 name: transcription factor Sp1 isoform 1 def: "A transcription factor Sp1 that is a translation product of a mature transcript of the SP1 gene, including all coding exons. Represented by the sequence UniProtKB:P08047-1." [PMID:10570957] comment: Category=sequence. synonym: "SP1/iso:1" EXACT PRO-short-label [] is_a: PR:000000133 ! transcription factor Sp1 [Term] id: PR:000000381 name: tumor necrosis factor alpha isoform 1 def: "A tumor necrosis factor alpha that is a translation product of a mature transcript of the TNF gene, and that contains a type II transmembrane domain, containing a C-terminus that is external to the cell and a cytoplasmic domain. Represented by the sequence UniProtKB:P01375-1." [PRO:CNA] comment: Category=sequence. synonym: "TNF/iso:1" EXACT PRO-short-label [] is_a: PR:000000134 ! tumor necrosis factor alpha [Term] id: PR:000000382 name: BMP receptor type-1A isoform 1 phosphorylated form def: "A BMPR1A isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000136 ! BMP receptor type-1A isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000383 name: BMP receptor type-1B isoform 1 phosphorylated form def: "A BMPR1B isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000145 ! BMP receptor type-1B isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000384 name: BMP10 isoform 1 def: "A BMP10 that is a translation product of a mature transcript of the BMP10 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:O95393-1. This form is the precursor." [PRO:CNA] comment: Category=sequence. synonym: "BMP10/iso:1" EXACT PRO-short-label [] is_a: PR:000000163 ! BMP10 [Term] id: PR:000000385 name: BMP2 isoform 1 def: "A BMP2 that is a translation product of a mature transcript of the BMP2 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P12643-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "BMP2/iso:1" EXACT PRO-short-label [] is_a: PR:000000164 ! BMP2 [Term] id: PR:000000386 name: BMP4 isoform 1 def: "A BMP4 that is a translation product of a mature transcript of the BMP4 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P12644-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "BMP4/iso:1" EXACT PRO-short-label [] is_a: PR:000000165 ! BMP4 [Term] id: PR:000000387 name: BMP5 isoform 1 def: "A BMP5 that is a translation product of a mature transcript of the BMP5 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P22003-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "BMP5/iso:1" EXACT PRO-short-label [] is_a: PR:000000166 ! BMP5 [Term] id: PR:000000388 name: BMP6 isoform 1 def: "A BMP6 that is a translation product of a mature transcript of the BMP6 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P22004-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "BMP6/iso:1" EXACT PRO-short-label [] is_a: PR:000000167 ! BMP6 [Term] id: PR:000000389 name: BMP7 isoform 1 def: "A BMP7 that is a translation product of a mature transcript of the BMP7 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P18075-1. This form is the precursor of the mature protein." [PRO:CNA] comment: Category=sequence. synonym: "BMP7/iso:1" EXACT PRO-short-label [] is_a: PR:000000168 ! BMP7 [Term] id: PR:000000390 name: BMP8A isoform 1 def: "A BMP8A that is a translation product of a mature transcript of the BMP8A gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:Q7Z5Y6-1. This form is the precursor of the mature protein." [PRO:CNA] comment: Category=sequence. synonym: "BMP8A/iso:1" EXACT PRO-short-label [] is_a: PR:000000169 ! BMP8A [Term] id: PR:000000391 name: BMP8B isoform 1 def: "A BMP8B that is a translation produce to a mature transcript of BMP8B gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P34820-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "BMP8B/iso:1" EXACT PRO-short-label [] is_a: PR:000000170 ! BMP8B [Term] id: PR:000000392 name: DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated form def: "A DNA-binding protein inhibitor ID-2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000173 ! DNA-binding protein inhibitor ID-2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000393 name: DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated form def: "A DNA-binding protein inhibitor ID-3 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000174 ! DNA-binding protein inhibitor ID-3 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000394 name: DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated form def: "A DNA-binding protein inhibitor ID-3 isoform 1 that has been post-translationally modified to include at least one ubiquitinated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000174 ! DNA-binding protein inhibitor ID-3 isoform 1 intersection_of: has_part MOD:01148 ! ubiquitinylated lysine [Term] id: PR:000000395 name: GTP-binding protein RhoA isoform 1 def: "A GTP-binding protein RhoA that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:P61586-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "RHOA/iso:1" EXACT PRO-short-label [] is_a: PR:000000176 ! GTP-binding protein RhoA [Term] id: PR:000000396 name: RING-box protein 2 isoform 1 phosphorylated form def: "A RING-box protein 2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000178 ! RING-box protein 2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000397 name: TGF-beta 1 isoform 1 def: "A TGF-beta 1 that is a translation product of a mature transcript of the TGFB1 gene, and includes all core domains (signal peptide, latent associated peptide and a transforming growth factor beta like domain). Represented by the sequence UniProtKB:P01137-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "TGFB1/iso:1" EXACT PRO-short-label [] synonym: "precursor" RELATED [] is_a: PR:000000182 ! TGF-beta 1 [Term] id: PR:000000398 name: TGF-beta 1 sequence variant 1 def: "A TGF-beta 1 that has a Pro residue at the position equivalent to Leu-10 in the human sequence UniProtKB:P01137-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000182 ! TGF-beta 1 [Term] id: PR:000000399 name: TGF-beta 1 sequence variant 2 def: "A TGF-beta 1 that has a His residue at the position equivalent to Tyr-81 in the human sequence UniProtKB:P01137-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000182 ! TGF-beta 1 [Term] id: PR:000000400 name: TGF-beta 1 sequence variant 3 def: "A TGF-beta 1 that has a Cys residue at the position equivalent to Arg-218 in the human sequence UniProtKB:P01137-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000182 ! TGF-beta 1 [Term] id: PR:000000401 name: TGF-beta 1 sequence variant 4 def: "A TGF-beta 1 that has a His residue at the position equivalent to Arg-218 in the human sequence UniProtKB:P01137-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000182 ! TGF-beta 1 [Term] id: PR:000000402 name: TGF-beta 1 sequence variant 5 def: "A TGF-beta 1 that has an Asp residue at the position equivalent to His-222 in the human sequence UniProtKB:P01137-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000182 ! TGF-beta 1 [Term] id: PR:000000403 name: TGF-beta 1 sequence variant 6 def: "A TGF-beta 1 that has an Arg residue at the position equivalent to Cys-225 in the human sequence UniProtKB:P01137-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000182 ! TGF-beta 1 [Term] id: PR:000000404 name: TGF-beta 2 isoform 1 def: "A TGF-beta 2 that is a translation product of a mature transcript of the TGFB2 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P61812-1. This form is a precursor and is upregulated in Alzheimer's disease." [PRO:CNA] comment: Category=sequence. synonym: "TGFB2/iso:1" EXACT PRO-short-label [] synonym: "isoform A" RELATED [] synonym: "TGF-beta 2(414)" RELATED [] is_a: PR:000000183 ! TGF-beta 2 [Term] id: PR:000000405 name: TGF-beta 2 isoform 2 def: "A TGF-beta 2 that is a translation product of a mature transcript of the TGFB2 gene, that has an insertion of around 30 amino acids in the propeptide region encoded by an additional cassette type exon, as in the exon between exons 1 and 2 (Exon 2b) in human. Represented by the sequence UniProtKB:P61812-2." [PMID:16868931, PMID:1777240, PMID:2850146, PRO:CNA] comment: Category=sequence. synonym: "TGFB2/iso:2" EXACT PRO-short-label [] synonym: "isoform B" RELATED [] synonym: "TGF-beta 2(442)" RELATED [] is_a: PR:000000183 ! TGF-beta 2 [Term] id: PR:000000406 name: TGF-beta 3 isoform 1 def: "A TGF-beta 3 that is a translation product of a mature transcript of the TGFB3 gene, and includes all core domains (signal peptide, latent associated peptide and a transforming growth factor beta like domain). Represented by the sequence UniProtKB:P10600-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "TGFB3/iso:1" EXACT PRO-short-label [] is_a: PR:000000184 ! TGF-beta 3 [Term] id: PR:000000407 name: TGF-beta receptor type-1 isoform 1 cleaved form def: "A TGF-beta receptor type-1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025411 that derives_from PR:000000185. is_obsolete: true consider: PR:000025411 [Term] id: PR:000000408 name: TGF-beta receptor type-1 isoform 1, signal peptide removed phosphorylated form def: "A TGF-beta receptor type-1 isoform 1, signal peptide removed form that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000522 ! TGF-beta receptor type-1 isoform 1, signal peptide removed form intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000409 name: TGF-beta receptor type-2 isoform 1, signal peptide removed form def: "A TGF-beta receptor type-2 isoform 1 that has had the signal peptide removed to yield the mature receptor." [PRO:CNA] comment: Category=modification. synonym: "TGFBR2/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "TGF-beta receptor type-2 isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000048 ! TGF-beta receptor type-2 isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000410 name: TGF-beta receptor type-2 isoform 1 phosphorylated 1 def: "A TGF-beta receptor type-2 phosphorylated form that has been phosphorylated as a result of EGF signaling pathway activation." [PRO:CNA] comment: Category=modification. is_a: PR:000000198 ! TGF-beta receptor type-2 isoform 1 phosphorylated form [Term] id: PR:000000411 name: activin receptor type-1 isoform 1, signal peptide removed phosphorylated form def: "An activin receptor type-1 isoform 1, signal peptide removed form that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000021938 ! activin receptor type-1 isoform 1, signal peptide removed form intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000412 name: activin receptor type-1B isoform 1 phosphorylated form def: "An activin receptor type-1B isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000201 ! activin receptor type-1B isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000413 name: activin receptor type-1C isoform 1 phosphorylated form def: "An activin receptor type-1C isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000204 ! activin receptor type-1C isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000414 name: activin receptor type-2A isoform 1 glycosylated and phosphorylated form def: "An activin receptor type-2A isoform 1 that has been post-translationally modified to include at least one glycosylated residue and at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000208 ! activin receptor type-2A isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000415 name: activin receptor type-2B isoform 1 glycosylated and phosphorylated form def: "An ACVR2B isoform 1 that has been post-translationally modified to include at least one glycosylated residue and at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000209 ! activin receptor type-2B isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000416 name: activin/inhibin beta A chain isoform 1 def: "An activin/inhibin beta A chain that is a translation product of a mature transcript of the INHBA gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P08476-1. This form is the precursor." [PMID:15319829, PRO:CNA] comment: Category=sequence. synonym: "INHBA/iso:1" EXACT PRO-short-label [] is_a: PR:000000216 ! activin/inhibin beta A chain [Term] id: PR:000000417 name: activin/inhibin beta B chain isoform 1 def: "An activin/inhibin beta B chain that is a translation product of a mature transcript of the INHBB gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P09529-1. This form is the precursor." [PMID:15319829] comment: Category=sequence. synonym: "INHBB/iso:1" EXACT PRO-short-label [] is_a: PR:000000217 ! activin/inhibin beta B chain [Term] id: PR:000000418 name: activin/inhibin beta E chain isoform 1 def: "An activin/inhibin beta E chain that is a translation product of a mature transcript of the INHBE gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P58166-1. This form is the precursor." [PMID:11134153] comment: Category=sequence. synonym: "INHBE/iso:1" EXACT PRO-short-label [] is_a: PR:000000219 ! activin/inhibin beta E chain [Term] id: PR:000000419 name: anti-Muellerian hormone isoform 1, signal peptide removed cleaved and glycosylated form def: "An anti-Muellerian hormone proteolytic cleavage product that is derived from anti-Muellerian hormone isoform 1, signal peptide removed form and been processed by proteolytic cleavage and post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "anti-Muellerian hormone isoform 1 cleaved and glycosylated form" EXACT [] intersection_of: PR:000001276 ! anti-Muellerian hormone proteolytic cleavage product intersection_of: derives_from PR:000021919 ! anti-Muellerian hormone isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000420 name: c-myc protein isoform 1 acetylated form def: "A c-myc protein isoform 1 that has been post-translationally modified to include at least one acetylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000228 ! c-myc protein isoform 1 intersection_of: has_part MOD:00394 ! acetylated residue [Term] id: PR:000000421 name: c-myc protein isoform 1 glycosylated form def: "A c-myc protein isoform 1 that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000228 ! c-myc protein isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000422 name: c-myc protein isoform 1 phosphorylated form def: "A c-myc protein isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000228 ! c-myc protein isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000423 name: cartilage oligomeric matrix protein isoform 1 cleaved form def: "A cartilage oligomeric matrix protein isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025416 that derives_from PR:000000230. is_obsolete: true consider: PR:000025416 [Term] id: PR:000000424 name: chordin isoform 1, signal peptide removed form def: "A chordin isoform 1 cleaved form that has had the signal peptide removed." [PRO:CNA] comment: Category=modification. synonym: "CHRD/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "chordin isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000086 ! chordin isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000425 name: chordin isoform 1 cleaved 2 def: "A chordin proteolytic cleavage product that is derived from chordin isoform 1 and that has been cleaved by BMP1 at two sites upstream of Asp residues. One site is within the motif Y[SN]DR, whereas the other is within the motif MQ[AS]DG. This form activates BMP signaling pathway." [PMID:10479448, UniProtKB:Q9Z0E2] comment: Category=modification. is_a: PR:000025419 ! chordin proteolytic cleavage product relationship: derives_from PR:000000086 ! chordin isoform 1 [Term] id: PR:000000426 name: creb-binding protein isoform 1 methylated form def: "A CREBBP isoform 1 that has been post-translationally modified to include at least one methylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000265 ! creb-binding protein isoform 1 intersection_of: has_part MOD:00427 ! methylated residue [Term] id: PR:000000427 name: cullin-1 isoform 1 neddylated form def: "A cullin-1 isoform 1 that has been post-translationally modified to include at least one neddylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000267 ! cullin-1 isoform 1 intersection_of: has_part MOD:01150 ! neddylated lysine [Term] id: PR:000000428 name: cyclin-dependent kinase 4 inhibitor B isoform 1 phosphorylated form def: "A CDKN2B isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000268 ! cyclin-dependent kinase 4 inhibitor B isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000429 name: decorin isoform 1, signal peptide removed cleaved and glycosylated form def: "A decorin proteolytic cleavage product that is derived from decorin isoform 1, signal peptide removed form that has been processed by proteolytic cleavage and post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "decorin isoform 1 cleaved and glycosylated form" EXACT [] intersection_of: PR:000018276 ! decorin proteolytic cleavage product intersection_of: derives_from PR:000021897 ! decorin isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000430 name: decorin isoform 1 cleaved form def: "A decorin isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018276 that derives_from PR:000000271. is_obsolete: true consider: PR:000018276 [Term] id: PR:000000431 name: fas ligand, TNF-like isoform 1 cleaved form def: "A fas ligand, TNF-like isoform FasL that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018277 that derives_from PR:000000276. is_obsolete: true consider: PR:000018277 [Term] id: PR:000000432 name: fas ligand, TNF-like isoform 1 glycosylated form def: "A fas ligand, TNF-like isoform FasL that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000276 ! fas ligand, TNF-like isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000433 name: follistatin isoform 1, signal peptide removed glycosylated form def: "A follistatin isoform 1, signal peptide removed form that has been glycosylated. This form is secreted and biologically active." [PRO:CNA] comment: Category=modification. synonym: "follistatin isoform 1 cleaved and glycosylated 1" EXACT [] intersection_of: PR:000025461 ! follistatin isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000434 name: follistatin isoform 1, signal peptide removed cleaved and glycosylated 2 def: "A follistatin isoform 1, signal peptide removed cleaved and glycosylated form that has had the C-terminal residues up to, but not including, the acidic region removed." [PMID:8340384, PRO:CNA] comment: Category=modification. synonym: "follistatin isoform 1 cleaved and glycosylated 2" EXACT [] synonym: "FS303" RELATED [] is_a: PR:000000279 ! follistatin isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000435 name: follistatin isoform 2, signal peptide removed glycosylated form def: "A follistatin isoform 2, signal peptide removed form that has been glycosylated." [PRO:CNA] comment: Category=modification. synonym: "follistatin isoform 2 cleaved and glycosylated 1" EXACT [] intersection_of: PR:000025462 ! follistatin isoform 2, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000436 name: growth/differentiation factor 5 isoform 1 def: "A growth/differentiation factor 5 that is a translation product of a mature transcript of the GDF5 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P43026-1." [PRO:CNA] comment: Category=sequence. synonym: "GDF5/iso:1" EXACT PRO-short-label [] is_a: PR:000000281 ! growth/differentiation factor 5 [Term] id: PR:000000437 name: growth/differentiation factor 5 sequence variant 1 def: "A growth/differentiation factor 5 that has a Tyr residue at the position equivalent to Cys-400 in the human sequence UniProtKB:P43026-1." [PMID:9288098, PRO:CNA] comment: Category=sequence. is_a: PR:000000281 ! growth/differentiation factor 5 [Term] id: PR:000000438 name: growth/differentiation factor 5 sequence variant 2 def: "A growth/differentiation factor 5 that has a Leu residue at the position equivalent to Arg-438 in the human sequence UniProtKB:P43026-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000281 ! growth/differentiation factor 5 [Term] id: PR:000000439 name: growth/differentiation factor 5 sequence variant 3 def: "A growth/differentiation factor 5 that has a Pro residue at the position equivalent to Leu-441 in the human sequence UniProtKB:P43026-1." [PMID:12121354, PRO:CNA] comment: Category=sequence. is_a: PR:000000281 ! growth/differentiation factor 5 [Term] id: PR:000000440 name: growth/differentiation factor 5 sequence variant 4 def: "A growth/differentiation factor 5 that has a polypeptide truncation at the position equivalent to residue 185 in the mouse sequence UniProtKB:P43027-1." [PMID:8145850, PRO:CNA] comment: Category=sequence. synonym: "bp-3J" RELATED [] is_a: PR:000000281 ! growth/differentiation factor 5 [Term] id: PR:000000441 name: growth/differentiation factor 5 sequence variant 5 def: "A growth/differentiation factor 5 that has a frameshift at the position equivalent to residue 376 in the mouse sequence UniProtKB:P43027-1." [PMID:8145850, PRO:CNA] comment: Category=sequence. is_a: PR:000000281 ! growth/differentiation factor 5 [Term] id: PR:000000442 name: growth/differentiation factor 7 isoform 1 def: "A growth/differentiation factor 7 that is a translation product of a mature transcript of the GDF7 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P43029-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "GDF7/iso:1" EXACT PRO-short-label [] is_a: PR:000000282 ! growth/differentiation factor 7 [Term] id: PR:000000443 name: growth/differentiation factor 7 isoform 2 def: "A growth/differentiation factor 7 that is a translation product of a mature transcript of the GDF7 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P43029-2. This form has a shorter propeptide as compared to PR:000000442." [PRO:CNA] comment: Category=sequence. synonym: "GDF7/iso:2" EXACT PRO-short-label [] is_a: PR:000000282 ! growth/differentiation factor 7 [Term] id: PR:000000444 name: inhibin beta C chain isoform 1 def: "An inhibin beta C chain protein that is a translation product of a mature transcript of the INHBC gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:P55103-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "INHBC/iso:1" EXACT PRO-short-label [] is_a: PR:000000218 ! activin/inhibin beta C chain [Term] id: PR:000000445 name: interferon gamma isoform 1, signal peptide removed form def: "An interferon gamma isoform 1 that has had the signal peptide removed to yield the mature protein." [PRO:CNA] comment: Category=modification. synonym: "IFNG/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "interferon gamma isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000100 ! interferon gamma isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000446 name: interferon gamma isoform 1, signal peptide removed glycosylated form def: "An interferon gamma isoform 1, signal peptide removed form that has been post-translationally modified to include at least one glycosylated residue." [PMID:3109913] comment: Category=modification. synonym: "interferon gamma isoform 1 cleaved and glycosylated 1" EXACT [] intersection_of: PR:000000445 ! interferon gamma isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000447 name: interferon gamma isoform 1, signal peptide removed cleaved and glycosylated 2 def: "An interferon gamma isoform 1, signal peptide removed cleaved and glycosylated form that is a mature protein with partial proteolytic degradation of the C-terminus." [PRO:CNA] comment: Category=modification. synonym: "interferon gamma isoform 1 cleaved and glycosylated 2" EXACT [] is_a: PR:000000283 ! interferon gamma isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000448 name: latent TGF-beta-binding protein 1 isoform 1 cleaved form def: "A latent TGF-beta-binding protein 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025430 that derives_from PR:000000285. is_obsolete: true consider: PR:000025430 [Term] id: PR:000000449 name: latent TGF-beta-binding protein 1 isoform 2 cleaved form def: "A latent TGF-beta-binding protein 1 isoform 1S that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025430 that derives_from PR:000000286. is_obsolete: true consider: PR:000025430 [Term] id: PR:000000450 name: lefty 1 isoform 1 def: "A lefty 1 that is a translation product of a mature transcript of the LEFTY1 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:O75610-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "LEFTY1/iso:1" EXACT PRO-short-label [] is_a: PR:000000287 ! lefty 1 [Term] id: PR:000000451 name: lefty 2 isoform 1 def: "A lefty 2 that is a translation product of a mature transcript of the LEFTY2 gene, and that contains a signal peptide, a propeptide and a TGF-beta-like cysteine knot domain. Represented by the sequence UniProtKB:O00292-1. This form is a precursor." [PRO:CNA] comment: Category=sequence. synonym: "LEFTY2/iso:1" EXACT PRO-short-label [] is_a: PR:000000288 ! lefty 2 [Term] id: PR:000000452 name: lefty 2 sequence variant 1 def: "A lefty 2 that has an Asn residue at the position equivalent to Ser-342 in the human sequence UniProtKB:O00292-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000288 ! lefty 2 [Term] id: PR:000000453 name: mitogen-activated protein kinase 1 isoform 1, initiator methionine removed acetylated form def: "A mitogen-activated protein kinase 1 isoform 1, initiator methionine removed form that has been post-translationally modified to include an acetylated residue." [PMID:12665801, PRO:CNA] comment: Category=modification. synonym: "mitogen-activated protein kinase 1 isoform 1 cleaved and acetylated form" EXACT [] intersection_of: PR:000025465 ! mitogen-activated protein kinase 1 isoform 1, initiator methionine removed form intersection_of: has_part MOD:00394 ! acetylated residue [Term] id: PR:000000454 name: mitogen-activated protein kinase 1 isoform 1 phosphorylated form def: "A MAPK1 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000289 ! mitogen-activated protein kinase 1 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000455 name: mitogen-activated protein kinase 3 isoform 1 phosphorylated form def: "A mitogen-activated protein kinase 3 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000290 ! mitogen-activated protein kinase 3 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000456 name: nodal protein isoform 1 cleaved form def: "A nodal protein isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025433 that derives_from PR:000000291. is_obsolete: true consider: PR:000025433 [Term] id: PR:000000457 name: noggin isoform 1, signal peptide removed form def: "A noggin isoform 1 that has had the signal peptide removed to yield the mature protein." [PRO:CNA] comment: Category=modification. synonym: "NOG/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "noggin isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000106 ! noggin isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000458 name: retinoblastoma-like protein 1 isoform 1 phosphorylated form def: "A retinoblastoma-like protein 1 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000303 ! retinoblastoma-like protein 1 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000459 name: retinoblastoma-like protein 2 isoform 1 phosphorylated form def: "A RBL2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000306 ! retinoblastoma-like protein 2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000460 name: rho-associated protein kinase 1 isoform 1 cleaved form def: "A rho-associated protein kinase 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025435 that derives_from PR:000000307. is_obsolete: true consider: PR:000025435 [Term] id: PR:000000461 name: rho-associated protein kinase 2 isoform 1 cleaved form def: "A rho-associated protein kinase 2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025436 that derives_from PR:000000308. is_obsolete: true consider: PR:000025436 [Term] id: PR:000000462 name: rho-associated protein kinase 2 isoform 1 phosphorylated form def: "A rho-associated protein kinase 2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000308 ! rho-associated protein kinase 2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000463 name: ribosomal protein S6 kinase beta-1 isoform 1 phosphorylated form def: "A ribosomal protein S6 kinase beta-1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000310 ! ribosomal protein S6 kinase beta-1 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000464 name: ribosomal protein S6 kinase beta-1 isoform 2 phosphorylated form def: "A ribosomal protein S6 kinase beta-1 isoform 2 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000311 ! ribosomal protein S6 kinase beta-1 isoform 2 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000465 name: ribosomal protein S6 kinase beta-2 isoform 1 phosphorylated form def: "A ribosomal protein S6 kinase beta-2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000312 ! ribosomal protein S6 kinase beta-2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000466 name: smad ubiquitination regulatory factor 1 isoform 1 def: "A smad ubiquitination regulatory factor 1 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q9HCE7-2 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "SMURF1/iso:1" EXACT PRO-short-label [] is_a: PR:000000361 ! smad ubiquitination regulatory factor 1 [Term] id: PR:000000467 name: smad1 isoform 1 def: "A smad1 that is a translation product of a mature transcript of the SMAD1 gene, and that contains the MH1 domain and the MH2 domain. Represented by the sequence UniProtKB:Q15797-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD1/iso:1" EXACT PRO-short-label [] is_a: PR:000000363 ! smad1 [Term] id: PR:000000468 name: smad2 isoform 1 def: "A smad2 that is a translation product of a mature transcript of the SMAD2 gene, and that contains the MH1 domain with the region encoded by exon 3, and the MH2 domain. Represented by the sequence UniProtKB:Q15796-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD2/iso:1" EXACT PRO-short-label [] synonym: "long isoform" RELATED [] is_a: PR:000000364 ! smad2 [Term] id: PR:000000469 name: smad2 isoform 2 def: "A smad2 that is a translation product of a mature transcript of the SMAD2 gene, and that contains the MH1 domain without the region encoded by exon 3, and the MH2 domain. Represented by the sequence UniProtKB:Q15796-2." [PMID:8752209] comment: Category=sequence. synonym: "SMAD2/iso:2" EXACT PRO-short-label [] synonym: "exon3delta" RELATED [] synonym: "short isoform" RELATED [] is_a: PR:000000364 ! smad2 [Term] id: PR:000000470 name: smad2 sequence variant 1 def: "A smad2 that has a Cys residue at the position equivalent to Arg-133 in the human sequence UniProtKB:Q15796-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000364 ! smad2 [Term] id: PR:000000471 name: smad2 sequence variant 2 def: "A smad2 that has an Arg residue at the position equivalent to Leu-440 in human sequence UniProtKB:Q15796-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000364 ! smad2 [Term] id: PR:000000472 name: smad2 sequence variant 3 def: "A smad2 that has a His residue at the position equivalent to Pro-445 in human sequence UniProtKB:Q15796-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000364 ! smad2 [Term] id: PR:000000473 name: smad2 sequence variant 4 def: "A smad2 that has a Glu residue at the position equivalent to Asp-450 in human sequence UniProtKB:Q15796-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000364 ! smad2 [Term] id: PR:000000474 name: smad2 sequence variant 5 def: "A smad2 that has an amino acid deletion at the position equivalent to region 344-458 in the human sequence UniProtKB:Q15796-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000364 ! smad2 [Term] id: PR:000000475 name: smad3 isoform 1 def: "A smad3 that is a translation product of a mature transcript of the SMAD3 gene, and that contains the MH1 domain and the MH2 domain. Represented by the sequence UniProtKB:P84022-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD3/iso:1" EXACT PRO-short-label [] is_a: PR:000000365 ! smad3 [Term] id: PR:000000476 name: smad4 isoform 1 phosphorylated form def: "A smad4 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000366 ! smad4 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000477 name: smad5 isoform 1 def: "A smad5 that is a translation product of a mature transcript of the SMAD5 gene, and that contains the MH1 domain and the MH2 domain. Represented by the sequence UniProtKB:Q99717-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD5/iso:1" EXACT PRO-short-label [] is_a: PR:000000372 ! smad5 [Term] id: PR:000000478 name: smad5 isoform 2 def: "A smad5 that is a translation product of a mature transcript of the SMAD5 gene comprising intron 6 generating a C-terminus truncated MH2 domain and a unique C-terminus sequence lacking the SSxS motif necessary for SMAD activation." [EST:AA169504, PMID:10845932] comment: Category=sequence. synonym: "SMAD5/iso:2" EXACT PRO-short-label [] synonym: "smad5 beta" RELATED [] is_a: PR:000000372 ! smad5 [Term] id: PR:000000479 name: smad6 isoform 1 def: "A smad6 that is a translation product of a mature transcript of the SMAD6 gene, and that contains the MH1 domain and the MH2 domain. Represented by the sequence UniProtKB:O43541-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD6/iso:1" EXACT PRO-short-label [] is_a: PR:000000373 ! smad6 [Term] id: PR:000000480 name: smad6 isoform 2 def: "A smad6 that is a translation product of a mature transcript of the SMAD6 gene, that lacks the MH1 domain. This form is exclusively expressed in coronary tissue and is upregulated in dissease heart tissue. Represented by the sequence UniProtKB:O43541-2." [PMID:11284962, PRO:CNA] comment: Category=sequence. synonym: "SMAD6/iso:2" EXACT PRO-short-label [] synonym: "isoform B" RELATED [] synonym: "short isoform" RELATED [] synonym: "smad6s" RELATED [] is_a: PR:000000373 ! smad6 [Term] id: PR:000000481 name: smad7 isoform 1 def: "A smad7 that is a translation product of a mature transcript of the SMAD7 gene, and that contains the MH1 domain and the MH2 domain. Represented by the sequence UniProtKB:O35253-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD7/iso:1" EXACT PRO-short-label [] is_a: PR:000000374 ! smad7 [Term] id: PR:000000482 name: smad9 isoform 1 def: "A smad9 that is a translation product of a mature transcript of the SMAD9 gene that lacks exon 3. Represented by the sequence UniProtKB:Q9JIW5-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD9/iso:1" EXACT PRO-short-label [] synonym: "MADH6b" RELATED [] synonym: "SMAD8a" RELATED [] is_a: PR:000000375 ! smad9 [Term] id: PR:000000483 name: smad9 isoform 2 def: "A smad9 that is a translation product of a mature transcript of the SMAD9 gene that lacks the last exon, and therefore the C-terminal SSxS motif. Inhibits BMP signaling." [PMID:10583507] comment: Category=sequence. synonym: "SMAD9/iso:2" EXACT PRO-short-label [] synonym: "SMAD8b" RELATED [] is_a: PR:000000375 ! smad9 [Term] id: PR:000000484 name: smad9 isoform 3 def: "A smad9 that is a translation product of a mature transcript of the SMAD9 gene, and that contains the MH1 domain and the MH2 domain. Represented by the sequence UniProtKB:O15198-1." [PRO:CNA] comment: Category=sequence. synonym: "SMAD9/iso:3" EXACT PRO-short-label [] is_a: PR:000000375 ! smad9 [Term] id: PR:000000485 name: thrombospondin-1 isoform 1, signal peptide removed cleaved and glycosylated form def: "A thrombospondin-1 isoform 1, signal peptide removed form that has been processed by proteolytic cleavage and post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "thrombospondin-1 isoform 1 cleaved and glycosylated form" EXACT [] intersection_of: PR:000025437 ! thrombospondin-1 proteolytic cleavage product intersection_of: derives_from PR:000000587 ! thrombospondin-1 isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000486 name: thrombospondin-1 isoform 1 cleaved form def: "A thrombospondin-1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025437 that derives_from PR:000000376. is_obsolete: true consider: PR:000025437 [Term] id: PR:000000487 name: thrombospondin-2 isoform 1 cleaved form def: "A thrombospondin-2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025438 that derives_from PR:000000377. is_obsolete: true consider: PR:000025438 [Term] id: PR:000000488 name: thrombospondin-3 isoform 1 cleaved form def: "A thrombospondin-3 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025439 that derives_from PR:000000378. is_obsolete: true consider: PR:000025439 [Term] id: PR:000000489 name: thrombospondin-4 isoform 1 cleaved form def: "A thrombospondin-4 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025440 that derives_from PR:000000379. is_obsolete: true consider: PR:000025440 [Term] id: PR:000000490 name: transcription factor Sp1 isoform 1 acetylated form def: "A transcription factor Sp1 isoform 1 that has been post-translationally modified to include at least one acetylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000380 ! transcription factor Sp1 isoform 1 intersection_of: has_part MOD:00394 ! acetylated residue [Term] id: PR:000000491 name: transcription factor Sp1 isoform 1 cleaved form def: "A transcription factor Sp1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025441 that derives_from PR:000000380. is_obsolete: true consider: PR:000025441 [Term] id: PR:000000492 name: transcription factor Sp1 isoform 1 glycosylated form def: "A transcription factor Sp1 isoform 1 that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000380 ! transcription factor Sp1 isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000493 name: transcription factor Sp1 isoform 1 phosphorylated form def: "A SP1 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000380 ! transcription factor Sp1 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000494 name: transcription factor Sp1 isoform 1 sumoylated form def: "A Sp1 isoform 1 that has been post-translationally modified to include at least one sumoylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000380 ! transcription factor Sp1 isoform 1 intersection_of: has_part MOD:01149 ! sumoylated lysine [Term] id: PR:000000495 name: tumor necrosis factor alpha isoform 1 cleaved form def: "A tumor necrosis factor alpha isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018285 that derives_from PR:000000381. is_obsolete: true consider: PR:000018285 [Term] id: PR:000000496 name: tumor necrosis factor alpha isoform 1 myristoylated form def: "A tumor necrosis factor alpha isoform 1 that has been post-translationally modified to include at least one myristoylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000381 ! tumor necrosis factor alpha isoform 1 intersection_of: has_part MOD:00438 ! myristoylated residue [Term] id: PR:000000497 name: tumor necrosis factor alpha isoform 1 phosphorylated form def: "A tumor necrosis factor alpha isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000381 ! tumor necrosis factor alpha isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000498 name: BMP receptor type-1A isoform 1 phosphorylated 1 def: "A BMP receptor type-1A isoform 1 phosphorylated form that has been phosphorylated at the GS-motif by the BMP receptor type-2 upon BMP ligand binding." [PMID:12829744] comment: Category=modification. is_a: PR:000000382 ! BMP receptor type-1A isoform 1 phosphorylated form [Term] id: PR:000000499 name: BMP receptor type-1A isoform 1 phosphorylated 2 def: "A BMP receptor type-1A isoform 1 phosphorylated form that has been phosphorylated upon EGF induction." [PMID:17081983] comment: Category=modification. is_a: PR:000000382 ! BMP receptor type-1A isoform 1 phosphorylated form [Term] id: PR:000000500 name: BMP receptor type-1B isoform 1 phosphorylated 1 def: "A BMP receptor type-1B isoform 1 phosphorylated form that has been phosphorylated at the GS-motif by the BMP receptor type-2 upon BMP ligand binding." [PRO:CNA] comment: Category=modification. synonym: "BMP receptor type-1B isoform 1 phosphorylated by BMPR2" EXACT [] synonym: "active receptor" RELATED [] is_a: PR:000000383 ! BMP receptor type-1B isoform 1 phosphorylated form [Term] id: PR:000000501 name: BMP2 isoform 1 cleaved form def: "A BMP2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018286 that derives_from PR:000000385. is_obsolete: true consider: PR:000018286 [Term] id: PR:000000502 name: BMP4 isoform 1 cleaved form def: "A BMP4 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018287 that derives_from PR:000000386. is_obsolete: true consider: PR:000018287 [Term] id: PR:000000503 name: BMP5 isoform 1 cleaved form def: "A BMP5 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000021931 that derives_from PR:000000387. is_obsolete: true consider: PR:000021931 [Term] id: PR:000000504 name: BMP6 isoform 1 cleaved form def: "A BMP6 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000021932 that derives_from PR:000000388. is_obsolete: true consider: PR:000021932 [Term] id: PR:000000505 name: BMP7 isoform 1, signal peptide removed cleaved and glycosylated form def: "BMP7 proteolytic cleavage product that is derived from BMP7 isoform 1 and has been processed by proteolytic cleavage and post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "BMP7 isoform 1 cleaved and glycosylated form" EXACT [] intersection_of: PR:000018288 ! BMP7 proteolytic cleavage product intersection_of: derives_from PR:000000389 ! BMP7 isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000506 name: BMP7 isoform 1 cleaved form def: "A BMP7 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018288 that derives_from PR:000000389. is_obsolete: true consider: PR:000018288 [Term] id: PR:000000507 name: DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated 1 def: "A DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue in the N-terminal SPVR motif." [PMID:9029153] comment: Category=modification. is_a: PR:000000392 ! DNA-binding protein inhibitor ID-2 isoform 1 phosphorylated form [Term] id: PR:000000508 name: DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated 1 def: "A DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue in the N-terminal SPVR motif." [PRO:CNA] comment: Category=modification. is_a: PR:000000393 ! DNA-binding protein inhibitor ID-3 isoform 1 phosphorylated form [Term] id: PR:000000509 name: DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated 1 def: "A DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated that has been ubiquitinated by COP9 signalosome complex for degradation." [PMID:15451666] comment: Category=modification. is_a: PR:000000394 ! DNA-binding protein inhibitor ID-3 isoform 1 ubiquitinated form [Term] id: PR:000000510 name: GTP-binding protein RhoA isoform 1 prenylated form def: "A GTP-binding protein RhoA isoform 1 that has been post-translationally modified to include at least one isoprenylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000395 ! GTP-binding protein RhoA isoform 1 intersection_of: has_part MOD:00703 ! isoprenylated residue [Term] id: PR:000000511 name: RING-box protein 2 isoform 1 phosphorylated 1 def: "A RING-box protein 2 isoform 1 phosphorylated form that has been phosphorylated at the most N-terminal Thr residue by CK2." [PMID:12748192] comment: Category=modification. is_a: PR:000000396 ! RING-box protein 2 isoform 1 phosphorylated form [Term] id: PR:000000512 name: TGF-beta 1 isoform 1, signal peptide removed cleaved and glycosylated form def: "A TGF-beta 1 proteolytic cleavage product that is derived from TGF-beta 1 isoform 1, signal peptide removed form that has been processed by proteolytic cleavage and post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "TGF-beta 1 isoform 1 cleaved and glycosylated form" EXACT [] intersection_of: PR:000018292 ! TGF-beta 1 proteolytic cleavage product intersection_of: derives_from PR:000025454 ! TGF-beta 1 isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000513 name: TGF-beta 1 isoform 1 cleaved form def: "A TGF-beta 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018292 that derives_from PR:000000397. is_obsolete: true consider: PR:000018292 [Term] id: PR:000000514 name: TGF-beta 1 sequence variant 2 cleaved form def: "A TGF-beta 1 sequence variant 2 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018292 that derives_from PR:000000399. is_obsolete: true consider: PR:000018292 [Term] id: PR:000000515 name: TGF-beta 1 sequence variant 3 cleaved form def: "A TGF-beta 1 sequence variant 3 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018292 that derives_from PR:000000400. is_obsolete: true consider: PR:000018292 [Term] id: PR:000000516 name: TGF-beta 1 sequence variant 4 cleaved form def: "A TGF-beta 1 sequence variant 4 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018292 that derives_from PR:000000401. is_obsolete: true consider: PR:000018292 [Term] id: PR:000000517 name: TGF-beta 1 sequence variant 5 cleaved form def: "A TGF-beta 1 sequence variant 5 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018292 that derives_from PR:000000402. is_obsolete: true consider: PR:000018292 [Term] id: PR:000000518 name: TGF-beta 1 sequence variant 6 cleaved form def: "A TGF-beta 1 sequence variant that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018292 that derives_from PR:000000403. is_obsolete: true consider: PR:000018292 [Term] id: PR:000000519 name: TGF-beta 2 isoform 1 cleaved form def: "A TGF-beta 2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018293 that derives_from PR:000000404. is_obsolete: true consider: PR:000018293 [Term] id: PR:000000520 name: TGF-beta 2 isoform 2 cleaved form def: "A TGF-beta 2 isoform 2 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018293 that derives_from PR:000000405. is_obsolete: true consider: PR:000018293 [Term] id: PR:000000521 name: TGF-beta 3 isoform 1 cleaved form def: "A TGF-beta 3 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018294 that derives_from PR:000000406. is_obsolete: true consider: PR:000018294 [Term] id: PR:000000522 name: TGF-beta receptor type-1 isoform 1, signal peptide removed form def: "A TGF-beta receptor type-1 isoform 1 that has had the signal peptide removed to yield the mature protein." [PRO:CNA] comment: Category=modification. synonym: "TGFBR1/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "TGF-beta receptor type-1 isoform 1 cleaved 1" EXACT [] synonym: "TGFBR1 inactive" EXACT [] intersection_of: PR:000000185 ! TGF-beta receptor type-1 isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000523 name: TGF-beta receptor type-1 isoform 1, signal peptide removed phosphorylated 1 def: "A TGF-beta receptor type-1 isoform 1, signal peptide removed phosphorylated form that has been phosphorylated in the GS-motif by TGFBR2. Phosphorylation of any of the Ser or Thr seems to be sufficient to transduce signal, however full activation is achieved when five of these residues are phosphorylated." [PMID:7774578, PMID:8947046] comment: Category=modification. synonym: "TGFBR1 active" EXACT [] synonym: "Phospho-TGF-beta 1 receptor" RELATED [Reactome:REACT_7508.1] is_a: PR:000000408 ! TGF-beta receptor type-1 isoform 1, signal peptide removed phosphorylated form [Term] id: PR:000000524 name: activin receptor type-1 isoform 1, signal peptide removed phosphorylated 1 def: "An activin receptor type-1 isoform 1, signal peptide removed phosphorylated form that has been phosphorylated at Ser/Thr residues in GS-motif by the activated activin receptor type-2 (PR:000000528, PR:000000529)." [PRO:CNA] comment: Category=modification. is_a: PR:000000411 ! activin receptor type-1 isoform 1, signal peptide removed phosphorylated form [Term] id: PR:000000525 name: activin receptor type-1B isoform 1 phosphorylated 1 def: "ACVR1B isoform 1 that is phosphorylated at Ser/Thr residues in GS-motif by activated activin receptor type-2, and constitutes an active receptor subunit." [PMID:8622651, PMID:8721982, PRO:CNA] comment: Category=modification. is_a: PR:000000412 ! activin receptor type-1B isoform 1 phosphorylated form [Term] id: PR:000000526 name: activin receptor type-1B isoform 1 phosphorylated 2 def: "An activin receptor type-1B isoform 1 that is phosphorylated at a Tyr residue within the protein kinase domain, as a result of platelet activation." [PMID:12112843, PRO:CNA] comment: Category=modification. is_a: PR:000000412 ! activin receptor type-1B isoform 1 phosphorylated form [Term] id: PR:000000527 name: activin receptor type-1C isoform 1 phosphorylated 1 def: "An activin receptor type-1C isoform 1 that is phosphorylated at Ser/Thr residues in the GS-motif by activated activin receptor type-2, and constitutes an active receptor subunit." [PMID:15196700] comment: Category=modification. is_a: PR:000000413 ! activin receptor type-1C isoform 1 phosphorylated form [Term] id: PR:000000528 name: activin receptor type-2A isoform 1 glycosylated and phosphorylated 1 def: "An activin receptor type-2A isoform 1 glycosylated and phosphorylated form that has been phosphorylated at Ser/Thr residues, and constitutes an active receptor subunit." [PMID:8395525] comment: Category=modification. is_a: PR:000000414 ! activin receptor type-2A isoform 1 glycosylated and phosphorylated form [Term] id: PR:000000529 name: activin receptor type-2B isoform 1 glycosylated and phosphorylated 1 def: "An activin receptor type-2B isoform 1 glycosylated and phosphorylated form that has been glycosylated and has been phosphorylated at Ser/Thr residues, and constitutes an active activin receptor subunit." [PRO:CNA] comment: Category=modification. is_a: PR:000000415 ! activin receptor type-2B isoform 1 glycosylated and phosphorylated form [Term] id: PR:000000530 name: activin/inhibin beta A chain isoform 1 cleaved form def: "An activin/inhibin beta A chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018295 that derives_from PR:000000416. is_obsolete: true consider: PR:000018295 [Term] id: PR:000000531 name: activin/inhibin beta B chain isoform 1 cleaved form def: "An activin/inhibin beta B chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000021927 that derives_from PR:000000417. is_obsolete: true consider: PR:000021927 [Term] id: PR:000000532 name: activin/inhibin beta E chain isoform 1 cleaved form def: "An activin/inhibin beta E chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000021928 that derives_from PR:000000418. is_obsolete: true consider: PR:000021928 [Term] id: PR:000000533 name: anti-Muellerian hormone isoform 1 cleaved and glycosylated 1 def: "An anti-Muellerian hormone isoform 1 cleaved and glycosylated form that has been cleaved after the signal peptide and also at the RxxR dibasic cleavage site releasing the propeptide. This form is the mature protein." [PMID:8755541, PRO:CNA] comment: The mature sequence in UniProtKb is not correct, therefore there is no glycosylation of the mature protein. This term has been replaced by PR:000000534. is_obsolete: true replaced_by: PR:000000534 [Term] id: PR:000000534 name: anti-Muellerian hormone isoform 1, signal peptide removed cleaved and glycosylated 2 def: "An anti-Muellerian hormone isoform 1, signal peptide removed cleaved and glycosylated form that has been cleaved at the RxxR dibasic cleavage site rendering the propeptide and the mature protein non-covalently bound." [PMID:14673134] comment: Category=modification. synonym: " anti-Muellerian hormone isoform 1 cleaved and glycosylated 2" EXACT [] is_a: PR:000000419 ! anti-Muellerian hormone isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000535 name: c-myc protein isoform 1 acetylated 1 def: "A c-myc protein isoform 1 acetylated form that has been acetylated at Lys residues by histone acetyltransferase p300." [PMID:16126174] comment: Category=modification. is_a: PR:000000420 ! c-myc protein isoform 1 acetylated form [Term] id: PR:000000536 name: c-myc protein isoform 1 glycosylated 1 def: "A c-myc protein isoform 1 glycosylated form that has been O-glycosylated at the Thr residue within the L[LY]PTLTPPLS sequence of the myc box I in the amino-terminal regulatory domain, as in Thr-58 of the human isoform 1." [PMID:11904304, PMID:7642555] comment: Category=modification. is_a: PR:000000421 ! c-myc protein isoform 1 glycosylated form [Term] id: PR:000000537 name: c-myc protein isoform 1 phosphorylated 1 def: "A c-myc protein isoform 1 phosphorylated form that has been phosphorylated at the Ser residue within the L[LY]PTLTPPLS sequence of the myc box I in the amino-terminal regulatory domain by ERK through activation of Raf signaling pathway, as in Ser-62 of the human isoform 1." [PMID:11018017] comment: Category=modification. is_a: PR:000000422 ! c-myc protein isoform 1 phosphorylated form [Term] id: PR:000000538 name: c-myc protein isoform 1 phosphorylated 2 def: "A c-myc protein isoform 1 phosphorylated form that has been phosphorylated at the Ser and Thr residues within the L[LY]PTLTPPLS sequence of the myc box I in the amino-terminal regulatory domain, by ERK and GSK3, respectively. As in residues Thr-58/Ser-62 of the human isoform 1. This form is not stable and is degraded through the proteosome pathway." [PMID:14563837, PMID:8386367] comment: Category=modification. is_a: PR:000000422 ! c-myc protein isoform 1 phosphorylated form [Term] id: PR:000000539 name: c-myc protein isoform 1 phosphorylated 3 def: "A c-myc protein isoform 1 phosphorylated form that has been phosphorylated at Ser residues of the myc box I in the amino-terminal regulatory domain by activation of ROCK proteins through Ras signaling pathway, as in Ser-62/Ser-71 of the human isoform 1." [PMID:12676581, UniProtKB:P01106] comment: Category=modification. is_a: PR:000000422 ! c-myc protein isoform 1 phosphorylated form [Term] id: PR:000000540 name: cartilage oligomeric matrix protein isoform 1, signal peptide removed form def: "A cartilage oligomeric matrix protein isoform 1 that has had the signal peptide removed to yield the mature protein." [PRO:CNA] comment: Category=modification. synonym: "COMP/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "cartilage oligomeric matrix protein isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000230 ! cartilage oligomeric matrix protein isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000541 name: creb-binding protein isoform 1 methylated 1 def: "A creb-binding protein isoform 1 methylated form that has been methylated at arginine residues within the KIX domain, as in Arg-600/Arg-624 of mouse isoform 1." [PMID:11701890] comment: Category=modification. is_a: PR:000000426 ! creb-binding protein isoform 1 methylated form [Term] id: PR:000000542 name: cullin-1 isoform 1 neddylated 1 def: "A cullin-1 isoform 1 neddylated form that has been neddylated in the conserved Lys residue within the IVR[ILV]MKxR[RK] motif. Example: UniProtKB:Q13616-1 has_part MOD:01150 neddylated lysine, Lys-720." [PMID:10713156] comment: Category=modification. is_a: PR:000000427 ! cullin-1 isoform 1 neddylated form [Term] id: PR:000000543 name: cyclin-dependent kinase 4 inhibitor B isoform 1 phosphorylated 1 def: "CDKN2B phosphorylated in residue equivalent to Thr-12 in mouse sequence." [UniProtKB:P55271] comment: Category=modification. is_a: PR:000000428 ! cyclin-dependent kinase 4 inhibitor B isoform 1 phosphorylated form [Term] id: PR:000000544 name: decorin isoform 1 cleaved 1 def: "A decorin isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, rendering the mature decorin protein core." [PRO:CNA] comment: Category=modification. intersection_of: PR:000018276 ! decorin proteolytic cleavage product intersection_of: derives_from PR:000021897 ! decorin isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000545 name: decorin isoform 1, signal peptide removed cleaved and glycosylated 1 def: "A decorin isoform 1, signal peptide removed cleaved and glycosylated form that has been processed to remove the propeptide and modified with O-linked glycosaminoglycan at the most N-terminal SG site and additional N-linked glycosylated Asn residues." [PMID:16258169] comment: Category=modification. synonym: "decorin isoform 1 cleaved and glycosylated 1" EXACT [] is_a: PR:000000429 ! decorin isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000546 name: fas ligand, TNF-like isoform 1 glycosylated 1 def: "A fas ligand, TNF-like isoform 1 glycosylated form that has been glycosylated at the Asn residues within the N-glycosylation sites located in the C-terminal extracellular region. This glycosylation does not appear to be required for receptor binding or biological activity." [PMID:9405425] comment: Category=modification. is_a: PR:000000432 ! fas ligand, TNF-like isoform 1 glycosylated form [Term] id: PR:000000547 name: fas ligand, TNF-like isoform FasL soluble def: "A fas ligand, TNF-like proteolytic cleavage product that is derived from fas ligand, TNF-like isoform 1 and that has been processed to the soluble form." [PRO:CNA] comment: Category=modification. is_a: PR:000018277 ! fas ligand, TNF-like proteolytic cleavage product relationship: derives_from PR:000000276 ! fas ligand, TNF-like isoform 1 [Term] id: PR:000000548 name: growth/differentiation factor 5 isoform 1 cleaved form def: "A growth/differentiation factor 5 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000021929 that derives_from PR:000000436. is_obsolete: true consider: PR:000021929 [Term] id: PR:000000549 name: growth/differentiation factor 7 isoform 1 cleaved form def: "A growth/differentiation factor 7 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000021930 that derives_from PR:000000442. is_obsolete: true consider: PR:000021930 [Term] id: PR:000000550 name: decorin isoform 1 cleaved 2 def: "A decorin proteolytic cleavage product that is derived from decorin isoform 1 and that has been cleaved after the Phe residue within the F[NS]GLN motif as a result of the catabolic processing of decorin. This form lacks most of the leucine-rich domains and is abundant in adult skin tissue." [PMID:12621051] comment: Category=modification. synonym: "decorunt" RELATED [] is_a: PR:000018276 ! decorin proteolytic cleavage product relationship: derives_from PR:000000271 ! decorin isoform 1 [Term] id: PR:000000551 name: inhibin beta C chain isoform 1 cleaved form def: "An inhibin beta C chain isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000021933 that derives_from PR:000000444. is_obsolete: true consider: PR:000021933 [Term] id: PR:000000552 name: latent TGF-beta-binding protein 1 isoform 2, signal peptide removed form def: "A latent TGF-beta-binding protein 1 isoform 2 that has had the signal peptide removed. This form binds covalently to the latent associated peptide of the transforming growth factors through the third TB domain by disulfide bridging." [PMID:14607119, PRO:CNA] comment: Category=modification. synonym: "LTBP1/iso:2/SigPep-" EXACT PRO-short-label [] synonym: "latent TGF-beta-binding protein 1 isoform 2 cleaved 1" EXACT [] intersection_of: PR:000000286 ! latent TGF-beta-binding protein 1 isoform 2 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000553 name: latent TGF-beta-binding protein 1 isoform 1, signal peptide removed form def: "A latent TGF-beta-binding protein 1 isoform 1 that has had the signal peptide removed. This form binds covalently to the latent associated peptide of the transforming growth factors through the third TB domain by disulfide bridging." [PRO:CNA] comment: Category=modification. synonym: "LTBP1/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "latent TGF-beta-binding protein 1 isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000285 ! latent TGF-beta-binding protein 1 isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000554 name: lefty 1 isoform 1 cleaved form def: "A lefty 1 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025431 that derives_from PR:000000450. is_obsolete: true consider: PR:000025431 [Term] id: PR:000000555 name: lefty 2 isoform 1 cleaved form def: "A lefty 2 isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000025432 that derives_from PR:000000451. is_obsolete: true consider: PR:000025432 [Term] id: PR:000000556 name: mitogen-activated protein kinase 1 isoform 1 phosphorylated 1 def: "A MAPK1 isoform 1 phosphorylated form that is phosphorylated at both Thr and Tyr of the TxY motif within the protein kinase domain." [PMID:17192257, PMID:1849075, PRO:CNA] comment: Category=modification. synonym: "ERK-2 active form" RELATED [] is_a: PR:000000454 ! mitogen-activated protein kinase 1 isoform 1 phosphorylated form [Term] id: PR:000000557 name: mitogen-activated protein kinase 3 isoform 1 phosphorylated 1 def: "A mitogen-activated protein kinase 3 isoform 1 phosphorylated form that is phosphorylated at both Thr and Tyr of the TxY motif within the protein kinase domain." [PMID:17192257, PRO:CNA] comment: Category=modification. synonym: "activated ERK1" RELATED [] synonym: "ERK1 active" RELATED [] synonym: "MAPK3 active form" RELATED [] synonym: "phospho-ERK-1" RELATED [] is_a: PR:000000455 ! mitogen-activated protein kinase 3 isoform 1 phosphorylated form [Term] id: PR:000000558 name: nodal protein isoform 1, signal peptide removed form def: "A nodal protein isoform 1 that has had the signal peptide removed to yield the mature protein." [PRO:CNA] comment: Category=modification. synonym: "NODAL/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "nodal protein isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000291 ! nodal protein isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000559 name: retinoblastoma-like protein 1 isoform 1 phosphorylated 1 def: "A retinoblastoma-like protein 1 phosphorylated form that has been phosphorylated in a RxL motif-dependent fashion by cyclin Cdk4." [PMID:11884610] comment: Category=modification. is_a: PR:000000458 ! retinoblastoma-like protein 1 isoform 1 phosphorylated form [Term] id: PR:000000560 name: retinoblastoma-like protein 2 isoform 1 phosphorylated 1 def: "A retinoblastoma-like protein 2 isoform 1 phosphorylated form that has been phosphorylated during Go/G1-S phase progression." [PRO:CNA] comment: Category=modification. is_a: PR:000000459 ! retinoblastoma-like protein 2 isoform 1 phosphorylated form [Term] id: PR:000000561 name: retinoblastoma-like protein 2 isoform 1 phosphorylated 2 def: "A retinoblastoma-like protein 2 isoform 1 phosphorylated form that has Cdk-dependent G1 phosphorylation, and additionally phosphorylated at a Ser residue within the region linking the retinoblastoma-associated protein A and B domains, by cyclin Cdk4(6). This phosphorylation leads to ubiquitin-dependent proteolysis." [PMID:12006580, PMID:12435635] comment: Category=modification. is_a: PR:000000459 ! retinoblastoma-like protein 2 isoform 1 phosphorylated form [Term] id: PR:000000562 name: retinoblastoma-like protein 2 isoform 1 phosphorylated 3 def: "A retinoblastoma-like protein 2 isoform 1 phosphorylated form as observed in quiescent cells." [PRO:CNA] comment: Category=modification. is_a: PR:000000459 ! retinoblastoma-like protein 2 isoform 1 phosphorylated form [Term] id: PR:000000563 name: rho-associated protein kinase 1 isoform 1 cleaved 1 def: "A rho-associated protein kinase 1 proteolytic cleavage product that is derived from rho-associated protein kinase 1 isoform 1 and that has been processed by caspase-3 downstream the sequence motif DETD, removing the inhibitory C-terminus. This form has been found significantly elevated in mouse myopathy model and human heart failure patients." [PMID:11283607, PMID:16983089] comment: Category=modification. synonym: "constitutively active ROCK-1" EXACT [] is_a: PR:000025435 ! rho-associated protein kinase 1 proteolytic cleavage product relationship: derives_from PR:000000307 ! rho-associated protein kinase 1 isoform 1 [Term] id: PR:000000564 name: rho-associated protein kinase 2 isoform 1 cleaved 1 def: "A rho-associated protein kinase 2 proteolytic cleavage product that is derived from rho-associated protein kinase 2 isoform 1 and that has been cleaved in the granzyme B consensus motif [IVL][GE]xD located between the rho binding and the PH domains, removing the C-terminus. This form has constitutive kinase activity." [PRO:CNA] comment: Category=modification. is_a: PR:000025436 ! rho-associated protein kinase 2 proteolytic cleavage product relationship: derives_from PR:000000308 ! rho-associated protein kinase 2 isoform 1 [Term] id: PR:000000565 name: rho-associated protein kinase 2 isoform 1 phosphorylated 1 def: "A rho-associated protein kinase 2 isoform 1 phosphorylated form that has been phosphorylated by the serine/threonine-protein kinase PLK1 in the C-terminal region." [PMID:17446864] comment: Category=modification. is_a: PR:000000462 ! rho-associated protein kinase 2 isoform 1 phosphorylated form [Term] id: PR:000000566 name: rho-associated protein kinase 2 isoform 1 phosphorylated 2 def: "A rho-associated protein kinase 2 isoform 1 phosphorylated form that has been induced by DNA damage." [PMID:17525332] comment: Category=modification. is_a: PR:000000462 ! rho-associated protein kinase 2 isoform 1 phosphorylated form [Term] id: PR:000000567 name: ribosomal protein S6 kinase beta-1 isoform 1 phosphorylated 1 def: "A ribosomal protein S6 kinase beta-1 isoform 1 phosphorylated within the AGC-kinase C-terminal domain. These sites serves as phosphorylation-regulated switches to control both intra- and inter-molecular interactions. Without these priming phosphorylations, the kinases are catalytically inactive." [PMID:1922062] comment: Category=modification. is_a: PR:000000463 ! ribosomal protein S6 kinase beta-1 isoform 1 phosphorylated form [Term] id: PR:000000568 name: ribosomal protein S6 kinase beta-1 isoform 2 phosphorylated 1 def: "A ribosomal protein S6 kinase beta-1 isoform 2 phosphorylated form that has been phosphorylated within the AGC-kinase C-terminal domain. These sites serve as phosphorylation-regulated switches to control both intra- and inter-molecular interactions. Without these priming phosphorylations, the kinases are catalytically inactive." [PMID:1922062] comment: Category=modification. is_a: PR:000000464 ! ribosomal protein S6 kinase beta-1 isoform 2 phosphorylated form [Term] id: PR:000000569 name: ribosomal protein S6 kinase beta-2 isoform 1 phosphorylated 1 def: "A ribosomal protein S6 kinase beta-2 phosphorylated form that has been phosphorylated upon activation of EGF receptor signaling pathway." [PMID:17081983] comment: Category=modification. is_a: PR:000000465 ! ribosomal protein S6 kinase beta-2 isoform 1 phosphorylated form [Term] id: PR:000000570 name: smad1 isoform 1 phosphorylated and ubiquitinated form def: "A smad1 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue and at least one ubiquitinated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000467 ! smad1 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue intersection_of: has_part MOD:01148 ! ubiquitinylated lysine [Term] id: PR:000000571 name: smad1 isoform 1 phosphorylated form def: "A smad1 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000467 ! smad1 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000572 name: smad2 isoform 1 acetylated and phosphorylated form def: "A smad2 isoform 1 that has been post-translationally modified to include at least one acetylated residue and at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000468 ! smad2 isoform 1 intersection_of: has_part MOD:00394 ! acetylated residue intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000573 name: smad2 isoform 1 phosphorylated and ubiquitinated form def: "A smad2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue and at least one ubiquitinated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000468 ! smad2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue intersection_of: has_part MOD:01148 ! ubiquitinylated lysine [Term] id: PR:000000574 name: smad2 isoform 1 phosphorylated form def: "A smad2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000468 ! smad2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000575 name: smad2 isoform 2 acetylated and phosphorylated form def: "A smad2 isoform 2 that has been post-translationally modified to include at least one acetylated residue and at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000469 ! smad2 isoform 2 intersection_of: has_part MOD:00394 ! acetylated residue intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000576 name: smad2 isoform 2 phosphorylated form def: "A smad2 isoform 2 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000469 ! smad2 isoform 2 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000577 name: smad3 isoform 1 acetylated and phosphorylated form def: "A smad3 isoform 1 that has been post-translationally modified to include at least one acetylated residue and at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000475 ! smad3 isoform 1 intersection_of: has_part MOD:00394 ! acetylated residue intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000578 name: smad3 isoform 1 phosphorylated form def: "A smad3 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000475 ! smad3 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000579 name: smad4 isoform 1 phosphorylated 1 def: "A smad4 isoform 1 phosphorylated form that has been phosphorylated at the PxTP motif within the MH1-MH2 domain linker region." [PMID:12801888] comment: Category=modification. is_a: PR:000000476 ! smad4 isoform 1 phosphorylated form [Term] id: PR:000000580 name: smad5 isoform 1 phosphorylated form def: "A smad5 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000477 ! smad5 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000581 name: smad6 isoform 1 methylated form def: "A smad6 isoform 1 that has been post-translationally modified to include at least one methylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000479 ! smad6 isoform 1 intersection_of: has_part MOD:00427 ! methylated residue [Term] id: PR:000000582 name: smad7 isoform 1 acetylated form def: "A smad7 isoform 1 that has been post-translationally modified to include at least one acetylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000481 ! smad7 isoform 1 intersection_of: has_part MOD:00394 ! acetylated residue [Term] id: PR:000000583 name: smad7 isoform 1 phosphorylated form def: "A smad7 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000481 ! smad7 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000584 name: smad7 isoform 1 ubiquitinated form def: "A smad7 isoform 1 that has been post-translationally modified to include at least one ubiquitinated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000481 ! smad7 isoform 1 intersection_of: has_part MOD:01148 ! ubiquitinylated lysine [Term] id: PR:000000585 name: smad9 isoform 1 phosphorylated form def: "A smad9 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000482 ! smad9 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000586 name: smad9 isoform 3 phosphorylated form def: "A smad9 isoform 3 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000484 ! smad9 isoform 3 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000587 name: thrombospondin-1 isoform 1, signal peptide removed form def: "A thrombospondin-1 isoform 1 that has had the signal peptide removed to yield the mature protein." [PRO:CNA] comment: Category=modification. synonym: "THBS1/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "thrombospondin-1 isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000376 ! thrombospondin-1 isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000588 name: thrombospondin-1 isoform 1 cleaved 2 def: "A thrombospondin-1 proteolytic cleavage product that is derived from thrombospondin-1 isoform 1 and that has been proteolytically processed by ADAMTS1 rendering an N-terminal domain product." [PMID:17082774] comment: Category=modification. is_a: PR:000025437 ! thrombospondin-1 proteolytic cleavage product relationship: derives_from PR:000000376 ! thrombospondin-1 isoform 1 [Term] id: PR:000000589 name: thrombospondin-1 isoform 1, signal peptide removed glycosylated form def: "A thrombospondin-1 isoform 1, signal peptide removed form that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. synonym: "thrombospondin-1 isoform 1 cleaved and glycosylated 1" EXACT [] intersection_of: PR:000000587 ! thrombospondin-1 isoform 1, signal peptide removed form intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000590 name: thrombospondin-1 isoform 1, signal peptide removed cleaved and glycosylated 2 def: "A thrombospondin-1 isoform 1, signal peptide removed cleaved and glycosylated form that has been proteolytically processed by ADAMTS1 rendering a C-terminal domain product." [PMID:17082774] comment: Category=modification. synonym: "thrombospondin-1 isoform 1 cleaved and glycosylated 2" EXACT [] is_a: PR:000000485 ! thrombospondin-1 isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000591 name: thrombospondin-2 isoform 1, signal peptide removed form def: "A thrombospondin-2 isoform 1 that has had the signal peptide removed to yield the mature protein." [PRO:CNA] comment: Category=modification. synonym: "THBS2/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "thrombospondin-2 isoform 1 cleaved 1" EXACT [] synonym: "mature protein" RELATED [] intersection_of: PR:000000377 ! thrombospondin-2 isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000592 name: thrombospondin-2 isoform 1 cleaved 2 def: "A thrombospondin-2 proteolytic cleavage product that is derived from thrombospondin-2 isoform 1 and that has been proteolytically processed by ADAMTS1 rendering an N-terminal domain product." [PMID:17082774] comment: Category=modification. is_a: PR:000025438 ! thrombospondin-2 proteolytic cleavage product relationship: derives_from PR:000000377 ! thrombospondin-2 isoform 1 [Term] id: PR:000000593 name: thrombospondin-2 isoform 1 cleaved 3 def: "A thrombospondin-2 proteolytic cleavage product that is derived from thrombospondin-2 isoform 1 and that has been proteolytically processed by ADAMTS1 rendering an C-terminal domain product." [PMID:17082774] comment: Category=modification. is_a: PR:000025438 ! thrombospondin-2 proteolytic cleavage product relationship: derives_from PR:000000377 ! thrombospondin-2 isoform 1 [Term] id: PR:000000594 name: thrombospondin-3 isoform 1, signal peptide removed form def: "A thrombospondin-3 isoform 1 that has had the signal peptide removed to yield the mature protein." [PMID:8654563] comment: Category=modification. synonym: "THBS3/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "thrombospondin-3 isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000378 ! thrombospondin-3 isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000595 name: thrombospondin-4 isoform 1, signal peptide removed form def: "A thrombospondin-4 isoform 1 that has had the signal peptide removed to yield the mature protein." [PMID:8654563] comment: Category=modification. synonym: "THBS4/iso:1/SigPep-" EXACT PRO-short-label [] synonym: "thrombospondin-4 isoform 1 cleaved 1" EXACT [] intersection_of: PR:000000379 ! thrombospondin-4 isoform 1 intersection_of: lacks_part SO:0000418 ! signal_peptide [Term] id: PR:000000596 name: transcription factor Sp1 isoform 1 acetylated 1 def: "A transcription factor Sp1 isoform 1 acetylated form that has been acetylated by PCAF." [PRO:CNA] comment: Category=modification. is_a: PR:000000490 ! transcription factor Sp1 isoform 1 acetylated form [Term] id: PR:000000597 name: transcription factor Sp1 isoform 1 cleaved 1 def: "A transcription factor Sp1 proteolytic cleavage product that is derived from transcription factor Sp1 isoform 1 and that has had the N-terminal inhibitory domain released." [PMID:16407261] comment: Category=modification. is_a: PR:000025441 ! transcription factor Sp1 proteolytic cleavage product relationship: derives_from PR:000000380 ! transcription factor Sp1 isoform 1 [Term] id: PR:000000598 name: transcription factor Sp1 isoform 1 glycosylated 1 def: "A transcription factor Sp1 isoform 1 glycosylated form that has terminal O-linked N-acetylglucosamines." [PMID:11371615] comment: Category=modification. is_a: PR:000000492 ! transcription factor Sp1 isoform 1 glycosylated form [Term] id: PR:000000599 name: transcription factor Sp1 isoform 1 phosphorylated 1 def: "A transcription factor Sp1 isoform 1 phosphorylated that has been phosphorylated at the N-terminal activation domains by a DNA-dependent protein kinase." [PMID:2170018] comment: Category=modification. is_a: PR:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form [Term] id: PR:000000600 name: transcription factor Sp1 isoform 1 phosphorylated 2 def: "A transcription factor Sp1 isoform 1 phosphorylated form that has been phosphorylated at a Thr residue in the C-terminal domain by casein kinase II." [PMID:9153193] comment: Category=modification. is_a: PR:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form [Term] id: PR:000000601 name: transcription factor Sp1 isoform 1 phosphorylated 3 def: "A transcription factor Sp1 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue within the CyclinA/cdk2 phosphorylation site (QPSP sequence). Phosphorylation at this site induces removal of the inhibitory domain by proteolytic processing and activation of transcription activity." [PMID:18239466] comment: Category=modification. is_a: PR:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form [Term] id: PR:000000602 name: transcription factor Sp1 isoform 1 phosphorylated 4 def: "A transcription factor Sp1 isoform 1 phosphorylated form that has been phosphorylated at the first serine/threonine stretch by ATM kinase in response to DNA damage." [PMID:18171990] comment: Category=modification. is_a: PR:000000493 ! transcription factor Sp1 isoform 1 phosphorylated form [Term] id: PR:000000603 name: transcription factor Sp1 isoform 1 sumoylated 1 def: "A transcription factor Sp1 isoform 1 sumoylated form that has a SUMO protein covalently linked to a Lys residue at the consensus motif VKIE within the N-terminal inhibitory domain." [PMID:16407261] comment: Category=modification. is_a: PR:000000494 ! transcription factor Sp1 isoform 1 sumoylated form [Term] id: PR:000000604 name: tumor necrosis factor alpha isoform 1 cleaved 1 def: "A tumor necrosis factor alpha proteolytic cleavage product that is derived from tumor necrosis factor alpha isoform 1 and that has been processed by TNF alpha converting enzyme ADAM17." [PMID:12135369] comment: Category=modification. is_a: PR:000018285 ! tumor necrosis factor alpha proteolytic cleavage product relationship: derives_from PR:000000381 ! tumor necrosis factor alpha isoform 1 [Term] id: PR:000000605 name: tumor necrosis factor alpha isoform 1 cleaved 2 def: "A tumor necrosis factor alpha proteolytic cleavage product that is derived from tumor necrosis factor alpha isoform 1 and that is an incompletely processed soluble form." [PMID:2777790] comment: Category=modification. is_a: PR:000018285 ! tumor necrosis factor alpha proteolytic cleavage product relationship: derives_from PR:000000381 ! tumor necrosis factor alpha isoform 1 [Term] id: PR:000000606 name: tumor necrosis factor alpha isoform 1 myristoylated 1 def: "A tumor necrosis factor alpha isoform 1 myristoylated form that has been modified at the N-epsilon-NH2 groups of the most N-terminal Lys within the cytoplasmic domain." [PMID:1402651] comment: Category=modification. is_a: PR:000000496 ! tumor necrosis factor alpha isoform 1 myristoylated form [Term] id: PR:000000607 name: tumor necrosis factor alpha isoform 1 phosphorylated 1 def: "A tumor necrosis factor alpha isoform 1 phosphorylated form that has been phosphorylated at the N-terminal Ser within the ST[EK]S motif in the cytoplasmic domain." [PMID:10205166] comment: Category=modification. is_a: PR:000000497 ! tumor necrosis factor alpha isoform 1 phosphorylated form [Term] id: PR:000000608 name: BMP2 isoform 1 cleaved 1 def: "A BMP2 isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein." [PMID:10074410] comment: Category=modification. intersection_of: PR:000018286 ! BMP2 proteolytic cleavage product intersection_of: derives_from PR:000021898 ! BMP2 isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000609 name: BMP4 isoform 1 cleaved 1 def: "A BMP4 isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein." [PMID:12805376] comment: Category=modification. intersection_of: PR:000018287 ! BMP4 proteolytic cleavage product intersection_of: derives_from PR:000021899 ! BMP4 isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000610 name: BMP5 isoform 1 cleaved 1 def: "A BMP5 isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein." [PRO:CNA] comment: Category=modification. intersection_of: PR:000021931 ! BMP5 proteolytic cleavage product intersection_of: derives_from PR:000021900 ! BMP5 isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000611 name: BMP6 isoform 1 cleaved 1 def: "A BMP6 isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein." [PMID:15969083] comment: Category=modification. intersection_of: PR:000021932 ! BMP6 proteolytic cleavage product intersection_of: derives_from PR:000021901 ! BMP6 isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000612 name: BMP7 isoform 1 cleaved 1 def: "A BMP7 proteolytic cleavage product that is derived from BMP7 isoform 1, signal peptide removed form and that has been processed to release the propeptide from the latent complex." [PRO:CNA] comment: Category=modification. is_a: PR:000018288 ! BMP7 proteolytic cleavage product relationship: derives_from PR:000021902 ! BMP7 isoform 1, signal peptide removed form [Term] id: PR:000000613 name: BMP7 isoform 1, signal peptide removed cleaved and glycosylated 1 def: "A BMP7 isoform 1, signal peptide removed cleaved and glycosylated form that has been processed to release the propeptide from the latent complex, and is N-glycosylated at the N{P}[ST]{P} motif. This form is a disulfide linked homodimer." [PMID:15929982, PRO:CNA] comment: Category=modification. synonym: "BMP7 isoform 1 cleaved and glycosylated 1" EXACT [] is_a: PR:000000505 ! BMP7 isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000614 name: BMP7 isoform 1, signal peptide removed cleaved and glycosylated 2 def: "A BMP7 isoform 1, signal peptide removed cleaved and glycosylated form that has been processed to a latent complex by removal of the propeptide which in turn remains bound to the mature protein. This form is N-glycosylated at the most C-terminal N{P}[ST]{P} motif and is a homodimer." [PMID:15929982] comment: Category=modification. synonym: "BMP7 isoform 1 cleaved and glycosylated 2" EXACT [] is_a: PR:000000505 ! BMP7 isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000615 name: GTP-binding protein RhoA isoform 1 prenylated 1 def: "A GTP-binding protein RhoA isoform 1 prenylated form where a geranylgeranyl moiety has been added to the Cys residue within the C-terminal Cxxx motif. Example: UniProtKB:P61586-1, has_part MOD:00113 S-geranylgeranyl-L-cysteine, Cys-190." [PMID:16773203, PRO:CNA] comment: Category=modification. is_a: PR:000000510 ! GTP-binding protein RhoA isoform 1 prenylated form [Term] id: PR:000000616 name: TGF-beta 1 isoform 1 cleaved 1 def: "A TGF-beta 1 proteolytic cleavage product that is derived from TGF-beta 1 isoform 1 and that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature protein." [PMID:3162913] comment: Category=modification. synonym: "active protein" RELATED [] synonym: "mature protein" RELATED [] is_a: PR:000018292 ! TGF-beta 1 proteolytic cleavage product relationship: derives_from PR:000000397 ! TGF-beta 1 isoform 1 [Term] id: PR:000000617 name: TGF-beta 1 isoform 1, signal peptide removed cleaved and glycosylated 1 def: "A TGF-beta 1 isoform 1, signal peptide removed cleaved and glycosylated form that has had the C-terminal mature peptide removed. This chain is referred as to the latent associated peptide (LAP). This form is glycosylated mainly at either one or the two first consensus glycosylation sites." [PMID:3162913] comment: Category=modification. synonym: "TGF-beta 1 isoform 1 cleaved and glycosylated 1" EXACT [] synonym: "LAP" RELATED [] synonym: "latent associated peptide" RELATED [] is_a: PR:000000512 ! TGF-beta 1 isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000618 name: TGF-beta 1 isoform 1, signal peptide removed cleaved and glycosylated 2 def: "A TGF-beta 1 isoform 1, signal peptide removed cleaved and glycosylated form that has cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound. This form is glycosylated mainly at either one or the two first consensus glycosylation sites within the LAP sequence." [PMID:3162913, PMID:3185545] comment: Category=modification. synonym: "TGF-beta 1 isoform 1 cleaved and glycosylated 2" EXACT [] synonym: "TGF beta latent complex" RELATED [] synonym: "TGFb latent complex" RELATED [] is_a: PR:000000512 ! TGF-beta 1 isoform 1, signal peptide removed cleaved and glycosylated form [Term] id: PR:000000619 name: TGF-beta 1 sequence variant 2 cleaved 1 def: "A TGF-beta 1 sequence variant 2, signal peptide removed form that has been processed by subsequent removal of the propeptide." [PMID:12493741] comment: Category=modification. intersection_of: PR:000018292 ! TGF-beta 1 proteolytic cleavage product intersection_of: derives_from PR:000021903 ! TGF-beta 1 sequence variant 2, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000620 name: TGF-beta 1 sequence variant 2 cleaved 2 def: "A TGF-beta 1 sequence variant 2, signal peptide removed form that has been processed by subsequent removal of the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PMID:12493741] comment: Category=modification. is_a: PR:000018292 ! TGF-beta 1 proteolytic cleavage product relationship: derives_from PR:000021903 ! TGF-beta 1 sequence variant 2, signal peptide removed form [Term] id: PR:000000621 name: TGF-beta 1 sequence variant 3 cleaved 1 def: "A TGF-beta 1 sequence variant 3, signal peptide removed form that has been processed by subsequent removal of the propeptide." [PMID:11278244] comment: Category=modification. intersection_of: PR:000018292 ! TGF-beta 1 proteolytic cleavage product intersection_of: derives_from PR:000021904 ! TGF-beta 1 sequence variant 3, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000622 name: TGF-beta 1 sequence variant 3 cleaved 2 def: "A TGF-beta 1 sequence variant 3, signal peptide removed form that has been processed by subsequent removal of the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP). This form has decreased affinity for the mature peptide (PR:000000621)." [PMID:11278244] comment: Category=modification. is_a: PR:000018292 ! TGF-beta 1 proteolytic cleavage product relationship: derives_from PR:000021904 ! TGF-beta 1 sequence variant 3, signal peptide removed form [Term] id: PR:000000623 name: TGF-beta 1 sequence variant 5 cleaved 1 def: "A TGF-beta 1 sequence variant 5, signal peptide removed form that has been processed by subsequent removal of the propeptide." [PMID:12493741] comment: Category=modification. intersection_of: PR:000018292 ! TGF-beta 1 proteolytic cleavage product intersection_of: derives_from PR:000021905 ! TGF-beta 1 sequence variant 5, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000624 name: TGF-beta 1 sequence variant 5 cleaved 2 def: "A TGF-beta 1 sequence variant 5, signal peptide removed form that has been processed by subsequent removal of the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PMID:12493741] comment: Category=modification. is_a: PR:000018292 ! TGF-beta 1 proteolytic cleavage product relationship: derives_from PR:000021905 ! TGF-beta 1 sequence variant 5, signal peptide removed form [Term] id: PR:000000625 name: TGF-beta 1 sequence variant 6 cleaved 1 def: "A TGF-beta 1 sequence variant 6, signal peptide removed form that has been processed by subsequent removal of the propeptide." [PRO:CNA] comment: Category=modification. intersection_of: PR:000018292 ! TGF-beta 1 proteolytic cleavage product intersection_of: derives_from PR:000021906 ! TGF-beta 1 sequence variant 6, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000626 name: TGF-beta 1 sequence variant 6 cleaved 2 def: "A TGF-beta 1 sequence variant 6, signal peptide removed form that has been processed by subsequent removal of the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PRO:CNA] comment: Category=modification. is_a: PR:000018292 ! TGF-beta 1 proteolytic cleavage product relationship: derives_from PR:000021906 ! TGF-beta 1 sequence variant 6, signal peptide removed form [Term] id: PR:000000627 name: TGF-beta 1 sequence variant 4 cleaved 1 def: "A TGF-beta 1 sequence variant 4, signal peptide removed form that has been processed by subsequent removal of the propeptide." [PMID:11278244] comment: Category=modification. intersection_of: PR:000018292 ! TGF-beta 1 proteolytic cleavage product intersection_of: derives_from PR:000021907 ! TGF-beta 1 sequence variant 4, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000628 name: TGF-beta 1 sequence variant 4 cleaved 2 def: "A TGF-beta 1 sequence variant 4, signal peptide removed form that has been processed by subsequent removal of the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP). This form has decreased affinity for the mature peptide." [PMID:11278244] comment: Category=modification. is_a: PR:000018292 ! TGF-beta 1 proteolytic cleavage product relationship: derives_from PR:000021907 ! TGF-beta 1 sequence variant 4, signal peptide removed form [Term] id: PR:000000629 name: TGF-beta 2 isoform 1 cleaved 1 def: "A TGF-beta 2 proteolytic cleavage product that is derived from TGF-beta 2 isoform 1 and that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature protein." [PMID:3476488] comment: Category=modification. synonym: "mature protein" RELATED [] is_a: PR:000018293 ! TGF-beta 2 proteolytic cleavage product relationship: derives_from PR:000000404 ! TGF-beta 2 isoform 1 [Term] id: PR:000000630 name: TGF-beta 2 isoform 1 cleaved 2 def: "A TGF-beta 2 isoform 1, signal peptide removed form that has been processed by subsequent removal of the C-terminal mature protein. This chain is referred as to the latent associated peptide (LAP)." [PRO:CNA] comment: Category=modification. is_a: PR:000018293 ! TGF-beta 2 proteolytic cleavage product relationship: derives_from PR:000021908 ! TGF-beta 2 isoform 1, signal peptide removed form [Term] id: PR:000000631 name: TGF-beta 2 isoform 1 cleaved 3 def: "A TGF-beta 2 isoform 1, signal peptide removed form that has been processed by subsequent cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound." [PMID:10224129] comment: Category=modification. is_a: PR:000018293 ! TGF-beta 2 proteolytic cleavage product relationship: derives_from PR:000021908 ! TGF-beta 2 isoform 1, signal peptide removed form [Term] id: PR:000000632 name: TGF-beta 2 isoform 2 cleaved 1 def: "A TGF-beta 2 proteolytic cleavage product that is derived from TGF-beta 2 isoform 2 and that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature peptide." [PMID:1777240] comment: Category=modification. is_a: PR:000018293 ! TGF-beta 2 proteolytic cleavage product relationship: derives_from PR:000000405 ! TGF-beta 2 isoform 2 [Term] id: PR:000000633 name: TGF-beta 2 isoform 2 cleaved 2 def: "A TGF-beta 2 isoform 2, signal peptide removed form that has been processed by subsequent cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound." [PMID:1777240] comment: Category=modification. is_a: PR:000018293 ! TGF-beta 2 proteolytic cleavage product relationship: derives_from PR:000021909 ! TGF-beta 2 isoform 2, signal peptide removed form [Term] id: PR:000000634 name: TGF-beta 3 isoform 1 cleaved 1 def: "A TGF-beta 3 proteolytic cleavage product that is derived from TGF-beta 3 isoform 1 and that has been processed by proteolytic cleavage and released from the latent complex. This form is the active mature peptide." [PRO:CNA] comment: Category=modification. is_a: PR:000018294 ! TGF-beta 3 proteolytic cleavage product relationship: derives_from PR:000000406 ! TGF-beta 3 isoform 1 [Term] id: PR:000000635 name: TGF-beta 3 isoform 1 cleaved 2 def: "A TGF-beta 3 proteolytic cleavage product that is derived from TGF-beta 3 isoform 1, signal peptide removed form and that has been processed by proteolytic cleavage to remove the C-terminal mature peptide. This chain is referred as to the latent associated peptide (LAP)." [PMID:11821050] comment: Category=modification. synonym: "TGFB3 lap" RELATED [] synonym: "TGFB3 latent associated peptide" RELATED [] is_a: PR:000018294 ! TGF-beta 3 proteolytic cleavage product relationship: derives_from PR:000021910 ! TGF-beta 3 isoform 1, signal peptide removed form [Term] id: PR:000000636 name: TGF-beta 3 isoform 1 cleaved 3 def: "A TGF-beta 3 isoform 1, signal peptide removed form that has been processed by subsequent cleavage at the dibasic cleavage site rendering the latent associated peptide (LAP) and the mature protein non-covalently bound." [PRO:CNA] comment: Category=modification. is_a: PR:000018294 ! TGF-beta 3 proteolytic cleavage product relationship: derives_from PR:000021910 ! TGF-beta 3 isoform 1, signal peptide removed form [Term] id: PR:000000637 name: activin/inhibin beta A chain isoform 1 cleaved 1 def: "An activin/inhibin beta A chain isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein. It is a subunit of inhibin A and activin A complexes. Inhibin A complex is a dimer of INHA and INHBA, whereas activin A complex is a homodimer of INHBA." [PMID:15948132] comment: Category=modification. intersection_of: PR:000018295 ! activin/inhibin beta A chain proteolytic cleavage product intersection_of: derives_from PR:000021911 ! activin/inhibin beta A chain isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000638 name: activin/inhibin beta B chain isoform 1 cleaved 1 def: "An activin/inhibin beta B chain isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein. It is a subunit of activin B, inhibin B and activin AB complexes. Activin B is a homodimer of INHBB. Inhibin B is a dimer of INHA and INHBB. Activin AB is a dimer of INHBA and INHBB." [PMID:3754442] comment: Category=modification. intersection_of: PR:000021927 ! activin/inhibin beta B chain proteolytic cleavage product intersection_of: derives_from PR:000021912 ! activin/inhibin beta B chain isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000639 name: activin/inhibin beta E chain isoform 1 cleaved 1 def: "An activin/inhibin beta E chain isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein." [PMID:1286533, PRO:CNA] comment: Category=modification. intersection_of: PR:000021928 ! activin/inhibin beta E chain proteolytic cleavage product intersection_of: derives_from PR:000021913 ! activin/inhibin beta E chain isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000640 name: growth/differentiation factor 5 isoform 1 cleaved 1 def: "A growth/differentiation factor 5 isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein. The functional unit is a dimer." [PMID:8962721, PRO:CNA] comment: Category=modification. intersection_of: PR:000021929 ! growth/differentiation factor 5 proteolytic cleavage product intersection_of: derives_from PR:000021914 ! growth/differentiation factor 5 isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000641 name: growth/differentiation factor 7 isoform 1 cleaved 1 def: "A growth/differentiation factor 7 isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein." [PRO:CNA] comment: Category=modification. intersection_of: PR:000021930 ! growth/differentiation factor 7 proteolytic cleavage product intersection_of: derives_from PR:000021915 ! growth/differentiation factor 7 isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000642 name: inhibin beta C chain isoform 1 cleaved 1 def: "An inhibin beta C chain isoform 1, signal peptide removed form that has been processed by subsequent removal of the propeptide, yielding the mature protein. It can form heterodimers with INHBB or INHBA." [PMID:11134153] comment: Category=modification. intersection_of: PR:000021933 ! activin/inhibin beta C chain proteolytic cleavage product intersection_of: derives_from PR:000021916 ! inhibin beta C chain isoform 1, signal peptide removed form intersection_of: lacks_part SO:0001062 ! propeptide [Term] id: PR:000000643 name: lefty 1 isoform 1 cleaved 1 def: "A lefty 1 proteolytic cleavage product that is derived from lefty 1 isoform 1 and that has been processed by proteolytic cleavage in the first dibasic RxxR cleavage site of the propeptide region." [PMID:11278322, PMID:18039650] comment: Category=modification. is_a: PR:000025431 ! lefty 1 proteolytic cleavage product relationship: derives_from PR:000000450 ! lefty 1 isoform 1 [Term] id: PR:000000644 name: lefty 1 isoform 1 cleaved 2 def: "A lefty 1 proteolytic cleavage product that is derived from lefty 1 isoform 1 and that has been processed by proteolytic cleavage in the second dibasic RxxR cleavage site of the propeptide region." [PMID:11278322] comment: Category=modification. is_a: PR:000025431 ! lefty 1 proteolytic cleavage product relationship: derives_from PR:000000450 ! lefty 1 isoform 1 [Term] id: PR:000000645 name: lefty 2 isoform 1 cleaved 1 def: "A lefty 2 proteolytic cleavage product that is derived from lefty 2 isoform 1 and that has been processed by proteolytic cleavage in the first dibasic RxxR cleavage site of the propeptide region." [PRO:CNA] comment: Category=modification. is_a: PR:000025432 ! lefty 2 proteolytic cleavage product relationship: derives_from PR:000000451 ! lefty 2 isoform 1 [Term] id: PR:000000646 name: lefty 2 isoform 1 cleaved 2 def: "A lefty 2 proteolytic cleavage product that is derived from lefty 2 isoform 1 and that has been processed by proteolytic cleavage in the second dibasic RxxR cleavage site of the propeptide region." [PRO:CNA] comment: Category=modification. is_a: PR:000025432 ! lefty 2 proteolytic cleavage product relationship: derives_from PR:000000451 ! lefty 2 isoform 1 [Term] id: PR:000000647 name: smad1 isoform 1 phosphorylated 1 def: "A smad1 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the bone morphogenetic protein (BMP) signaling pathway." [PMID:9136927] comment: Category=modification. synonym: "BMP receptor-activated smad1" EXACT [] synonym: "phospho-R-smad1" EXACT [Reactome:REACT_12354.1] is_a: PR:000000571 ! smad1 isoform 1 phosphorylated form [Term] id: PR:000000648 name: smad1 isoform 1 phosphorylated and ubiquitinated 1 def: "A smad1 isoform 1 phosphorylated and ubiquitinated form that has been phosphorylated at the two last C-terminal SSxS motif and has been ubiquitinated by smad ubiquitination regulatory factor 1 (PR:000000466)." [PMID:12857866] comment: Category=modification. is_a: PR:000000570 ! smad1 isoform 1 phosphorylated and ubiquitinated form [Term] id: PR:000000649 name: smad2 isoform 1 acetylated and phosphorylated 1 def: "A smad2 isoform 1 acetylated and phosphorylated form that has been phosphorylated by TGF-beta receptor activation and further acetylated at a Lys residue within the MH1 domain by coactivators, such as CBP, PCAF and EP300." [PMID:17074756] comment: Category=modification. synonym: "smad2 sequence 1 acetylated-1 and phosphorylated-1" EXACT [] is_a: PR:000000572 ! smad2 isoform 1 acetylated and phosphorylated form [Term] id: PR:000000650 name: smad2 isoform 1 phosphorylated 1 def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated in the last two Ser residues within the SSxS C-terminal motif by TGF-beta pathway activation." [PMID:8980228, PMID:9346966] comment: Category=modification. synonym: "TGF-beta receptor-activated smad2" RELATED [] is_a: PR:000000574 ! smad2 isoform 1 phosphorylated form [Term] id: PR:000000651 name: smad2 isoform 1 phosphorylated 2 def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated at the N-terminal Px[ST]P motif and multiple Ser and/or Thr residues in the linker region by ERK1." [PMID:12193595] comment: Category=modification. is_a: PR:000000574 ! smad2 isoform 1 phosphorylated form [Term] id: PR:000000652 name: smad2 isoform 1 phosphorylated 3 def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated at a [S/T] residue within the MH1-MH2 domain linker region in response to decorin-induced Ca(2+) signaling." [PMID:11027280] comment: Category=modification. is_a: PR:000000574 ! smad2 isoform 1 phosphorylated form [Term] id: PR:000000653 name: smad2 isoform 1 phosphorylated 4 def: "A smad2 isoform 1 phosphorylated form that has been phosphorylated at the clusters of [S/T]P motifs within the MH1-MH2 domain linker region through the MAP kinase cascade in the oncogenic Ras-activated pathway." [PMID:10197981] comment: Category=modification. is_a: PR:000000574 ! smad2 isoform 1 phosphorylated form [Term] id: PR:000000654 name: smad2 isoform 1 phosphorylated and ubiquitinated 1 def: "A smad2 isoform 1 phosphorylated and ubiquitinated form that has been phosphorylated by TGF-beta receptor activation and further ubiquitinated by NEDD4L. This form is targeted for proteosomal degradation." [PMID:15496141] comment: Category=modification. is_a: PR:000000573 ! smad2 isoform 1 phosphorylated and ubiquitinated form [Term] id: PR:000000655 name: smad2 isoform 2 acetylated and phosphorylated 1 def: "A smad2 isoform 2 phosphorylated form that has been phosphorylated in the last two Ser residues within the SSxS C-terminal motif by TGF-beta pathway activation and acetylated in a Lys residue within the MH1 domain by coactivators, such as CBP, PCAF and EP300." [PMID:17074756] comment: Category=modification. is_a: PR:000000575 ! smad2 isoform 2 acetylated and phosphorylated form [Term] id: PR:000000656 name: smad2 isoform 2 phosphorylated 1 def: "A smad2 isoform 2 phosphorylated form that has been phosphorylated in the last two Ser residues within the SSxS C-terminal motif by TGF-beta pathway activation." [PMID:15630024, PMID:17074756, PMID:9873005] comment: Category=modification. synonym: "TGF-beta receptor-activated smad2" RELATED [] is_a: PR:000000576 ! smad2 isoform 2 phosphorylated form [Term] id: PR:000000657 name: smad3 isoform 1 acetylated and phosphorylated 1 def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated by TGF-beta receptor activation and further acetylated in a Lys residue within the MH1 domain by coactivators, such as CBP and EP300." [PMID:17074756] comment: Category=modification. is_a: PR:000000577 ! smad3 isoform 1 acetylated and phosphorylated form [Term] id: PR:000000658 name: smad3 isoform 1 phosphorylated 1 def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the transforming growth factor beta signaling pathway." [PMID:8774881] comment: Category=modification. synonym: "smad3 active" EXACT [] synonym: "TGF-beta receptor-activated smad3" RELATED [] is_a: PR:000000578 ! smad3 isoform 1 phosphorylated form [Term] id: PR:000000659 name: smad3 isoform 1 phosphorylated 2 def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated at the N-terminal Px[ST]P motif and the clusters of [ST]P motifs within the MH1-MH2 domain linker region by G1 cyclin-dependent kinases (CDK4 and CDK2) leading to CDK inhibition of its transcriptional activity and antiproliferative function." [PMID:15241418] comment: Category=modification. is_a: PR:000000578 ! smad3 isoform 1 phosphorylated form [Term] id: PR:000000660 name: smad3 isoform 1 phosphorylated 3 def: "A smad3 isoform 1 phosphorylated form that has been phosphorylated at the clusters of [S/T]P motifs within the MH1-MH2 domain linker region through the MAP kinase cascade in oncogenic Ras-activated pathway. TGF-receptor phosphorylation sites are not required for Ras-induced phosphorylation." [PMID:10197981] comment: Category=modification. is_a: PR:000000578 ! smad3 isoform 1 phosphorylated form [Term] id: PR:000000661 name: smad5 isoform 1 phosphorylated 1 def: "A smad5 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the bone morphogenetic protein (BMP) signaling pathway." [PMID:8637600] comment: Category=modification. synonym: "phospho-R-smad5" EXACT [Reactome:REACT_12102.1] is_a: PR:000000580 ! smad5 isoform 1 phosphorylated form [Term] id: PR:000000662 name: smad6 isoform 1 methylated 1 def: "A smad6 sequence 1 dimethylated form that has been methylated at Arginine residue within the MH1 domain by PRMT1." [PMID:17118358] comment: Category=modification. is_a: PR:000000581 ! smad6 isoform 1 methylated form [Term] id: PR:000000663 name: smad7 isoform 1 acetylated 1 def: "A smad7 isoform 1 acetylated form that has been acetylated at Lys residues within the MH1 domain by Histone acetyltransferase p300. Acetylation stabilizes smad7." [PMID:12408818] comment: Category=modification. is_a: PR:000000582 ! smad7 isoform 1 acetylated form [Term] id: PR:000000664 name: smad7 isoform 1 phosphorylated 1 def: "A smad7 isoform 1 phosphorylated form that has been phosphorylated at the Ser residue within the DSQL sequence region in the MH2 domain." [PRO:CNA] comment: Category=modification. is_a: PR:000000583 ! smad7 isoform 1 phosphorylated form [Term] id: PR:000000665 name: smad7 isoform 1 ubiquitinated 1 def: "A smad7 isoform 1 ubiquitinated form that has been ubiquitinated at Lys residues within the MH1 domain by Smurf proteins. This targets smad7 for proteosomal degradation." [PMID:12408818] comment: Category=modification. is_a: PR:000000584 ! smad7 isoform 1 ubiquitinated form [Term] id: PR:000000666 name: smad9 isoform 1 phosphorylated 1 def: "A smad9 isoform 1 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif as a result of the activation of the bone morphogenetic protein (BMP) signaling pathway." [PMID:15542835] comment: Category=modification. synonym: "phospho-R-smad9" RELATED [Reactome:REACT_12302.1] is_a: PR:000000585 ! smad9 isoform 1 phosphorylated form [Term] id: PR:000000667 name: smad9 isoform 3 phosphorylated 1 def: "A smad9 isoform 3 phosphorylated form that has been phosphorylated at the C-terminal SSxS motif." [PMID:17081983, PRO:CNA] comment: Category=modification. is_a: PR:000000586 ! smad9 isoform 3 phosphorylated form [Term] id: PR:000000668 name: calcium-activated calmodulin-binding potassium channel alpha subunit def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. They are subunits of the small conductance calcium-activated channels. SK channels are independent of voltage and gated solely by intracellular calcium. These membrane channels are heteromeric complexes that comprise pore-forming alpha-subunits and the calcium-binding protein calmodulin. Calmodulin binds to the SK channel through the Calmodulin binding domain (PF02888), which is located in an intracellular region of the alpha-subunit immediately carboxy-terminal to the pore. Channel opening is triggered when calcium binds the EF hands in the N-lobe of calmodulin. These channels play a crucial role in hyperpolarizing the membrane potential of excitable and nonexcitable cells." [PMID:10026195, PMID:11323678] comment: Category=family. xref: PIRSF:PIRSF038511 is_a: PR:000000001 ! protein [Term] id: PR:000000669 name: cation channel sperm-associated protein 1 def: "A protein that is a translation product of the CATSPER1 gene or a 1:1 ortholog thereof. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel. CatSper channels seem to require auxiliary subunits, such as CatSperB (PR:000000672). In common with other channels, CatSper1 proteins have an architecture consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. Unique to this class is the His-rich N-terminus that seems to be involved the pH sensitivity of the channel calcium currents." [PRO:CNA] comment: Category=gene. synonym: "CATSPER1" EXACT PRO-short-label [] synonym: "CatSper1" EXACT [DNx] synonym: "hCatSper" EXACT [] is_a: PR:000000001 ! protein [Term] id: PR:000000670 name: cation channel sperm-associated protein 2 def: "A protein that is a translation product of the CATSPER2 gene or a 1:1 ortholog thereof. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel. CatSper channels seem to require auxiliary subunits, such as CatSperB (PR:000000672). In common with other channels, CatSper2 proteins have an architecture consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane." [PRO:CNA] comment: Category=gene. synonym: "CATSPER2" EXACT PRO-short-label [] synonym: "CatSper2" EXACT [DNx] is_a: PR:000000001 ! protein [Term] id: PR:000000671 name: cation channel sperm-associated protein 3 def: "A protein that is a translation product of the CATSPER3 gene or a 1:1 ortholog thereof. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel. CatSper channels seem to require auxiliary subunits, such as CatSperB (PR:000000672). In common with other channels, CatSper3 proteins have an architecture consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane." [PRO:CNA] comment: Category=gene. synonym: "CATSPER3" EXACT PRO-short-label [] synonym: "Ca(v)-like protein" EXACT [] synonym: "CatSper3" EXACT [DNx] synonym: "one-repeat calcium channel-like protein" EXACT [] is_a: PR:000000001 ! protein [Term] id: PR:000000672 name: cation channel sperm-associated protein subunit beta def: "A protein that is a translation product of the CATSPERB gene or a 1:1 ortholog thereof. Members of this class are auxiliary proteins to the CatSper channel. They have four putative transmembrane-spanning domains. In mammals, four CatSper ion channel subunit genes (CatSpers 1-4) are required for sperm cell hyperactivation and male fertility. The four proteins assemble (presumably as a tetramer) to form a sperm-specific, alkalinization-activated Ca(2+)-selective channel." [PMID:17478420, PRO:CNA] comment: Category=gene. synonym: "CATSPERB" EXACT PRO-short-label [] synonym: "CatSper-beta" EXACT [DNx] synonym: "C14orf161" RELATED [] xref: PIRSF:PIRSF038543 is_a: PR:000000001 ! protein [Term] id: PR:000000673 name: cyclic nucleotide-gated channel alpha subunit def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The carboxy-terminal region contains the Cyclic nucleotide-binding domain (PF00027) (CNBD) and a region connecting the CNBD to the S6 segment (C-linker), which is important for modulation by transition metals. In addition, CNG alpha has a carboxy-terminal leucine zipper that seems to be involved in inter-subunit interaction. CNG alpha subunits combine with the beta subunits to form the cyclic nucleotide-gated ion channels, which mediate sensory transduction in photoreceptors and olfactory sensory neurons. These channels are likely composed of four subunits around a centrally located ion-permeable pore that opens in response to the direct binding of intracellular cyclic nucleotides. CNG channels are non-selective cation channels. They are not gated by membrane voltage although their structure includes the transmembrane S4 motif known to function as the membrane voltage sensor in all voltage-gated ion channels, but it has been shown to be important for proper folding and processing. Alpha and beta subunits of the CNG channel are very similar, however only alpha subunits are able to homooligomerize and form functional channels." [PMID:12432397, PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF002403 is_a: PR:000000001 ! protein [Term] id: PR:000000674 name: cyclic nucleotide-gated channel beta subunit def: "A protein that is a modulatory subunit of the cyclic nucleotide-gated channel (CNG channel). It consists of amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The carboxy-terminal region contains the Cyclic nucleotide-binding domain (PF00027) (CNBD) and a region connecting the CNBD to the S6 segment (C-linker), which is important for modulation by transition metals. CNG beta subunits combine with the alpha subunits to form the cyclic nucleotide-gated ion channels, which mediate sensory transduction in photoreceptors and olfactory sensory neurons. These channels are likely composed of four subunits around a centrally located ion-permeable pore that opens in response to the direct binding of intracellular cyclic nucleotides. CNG channels are non-selective cation channels. They are not gated by membrane voltage although their structure includes the transmembrane S4 motif known to function as the membrane voltage sensor in all voltage-gated ion channels, but it has been shown to be important for proper folding and processing. Alpha and beta subunits of the CNG channel are very similar, however the beta subunits are not able to form functional channels by themselves." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF038515 is_a: PR:000000001 ! protein [Term] id: PR:000000675 name: platelet-derived growth factor with CUB domain def: "A protein with a core domain composition consisting of a signal peptide, a CUB domain (PF00431), and a C-terminal Platelet-derived growth factor (PDGF) domain (PF00341)." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF038533 is_a: PR:000000001 ! protein [Term] id: PR:000000676 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The N-terminus has a conserved domain that is also present in other voltage-gated potassium and sodium channels. The carboxyl-terminal region contains the cyclic nucleotide-binding domain (CNBD). In addition, there is a structural element called the C-linker, the region connecting the CNBD to the S6 segment, which couples conformational changes in the ligand-binding domain to channel activation. Subunits combine to form the HCN channels. In common with CNG channels, HCN are cation channels that are modulated by cyclic nucleotide binding. Unlike CNG channels, HCN channels are voltage-gated, and are weakly selective for potassium. In contrast to most other voltage-gated channels, HCN channels open upon hyperpolarization and close at positive potential. HCN channels act as a pacemaker by regulating neuronal and cardiac firing rate, but also function as a regulator of membrane resting potential and resistance." [PMID:16382102] comment: Category=family. synonym: "f-channel" EXACT [] synonym: "HCN" RELATED [] xref: PIRSF:PIRSF038514 is_a: PR:000000001 ! protein [Term] id: PR:000000677 name: shab-related voltage-gated potassium channel alpha subunit def: "A protein that has a conserved carboxyl terminal domain called the Kv2 channel domain. Kv2 channels are known as delayed rectifier channels. Shab-related voltage-potassium channels are involved in maintaining membrane potential and modulating electrical excitability in neurons. In common with other voltage-gated channels, has a domain composition consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. The charged S4 segment with a basic amino acid at every third position confers their voltage sensitivity. In common with Kv3 and Kv4 channels, the tetramerization domain at the N-terminus contains a zinc binding site." [PRO:CNA] comment: Category=family. synonym: "Kv2 channel" RELATED [] xref: PIRSF:PIRSF038520 is_a: PR:000000001 ! protein [Term] id: PR:000000678 name: sodium leak channel non-selective protein def: "A protein that is a translation product of the NALCN gene or a 1:1 ortholog thereof. The prototype subunit contains four copies of the six transmembrane ion transport protein domain, but the number of copies of this domain varies among splice variants. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability. They are subunits of a voltage-independent, nonselective cation channel." [PMID:17448995, PRO:CNA] comment: Category=gene. synonym: "NALCN" EXACT PRO-short-label [] synonym: "CanIon" EXACT [DNx] synonym: "voltage gated channel-like protein 1" EXACT [] synonym: "VGCNL1" RELATED [] xref: PIRSF:PIRSF038547 is_a: PR:000000001 ! protein [Term] id: PR:000000679 name: transient receptor potential cation channel TRPA def: "A protein that is a member of the subfamily A of the transient receptor potential cation channels (TRPs), with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The amino terminal domain contains 14-16 copies of Ankyrin repeat (PF00023). Most TRPs are relatively non-selective. They may be modulated by voltage changes but channel gating is generally effected by other means." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB] comment: Category=family. xref: PIRSF:PIRSF038535 is_a: PR:000000001 ! protein [Term] id: PR:000000680 name: transient receptor potential cation channel TRPC def: "A protein that is a member of the subfamily C of the transient receptor potential cation channels (TRPs), with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The amino terminal domain contains up to 4 detectable copies of Ankyrin repeat (PF00023) followed by the Transient receptor ion channel II domain (PF08344). Most TRPs are relatively non-selective. They may be modulated by voltage changes but channel gating is generally effected by other means." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB] comment: Category=family. xref: PIRSF:PIRSF005528 is_a: PR:000000001 ! protein [Term] id: PR:000000681 name: transient receptor potential cation channel TRPV def: "A protein that is a member of the subfamily V of the transient receptor potential cation channels (TRPs), with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. The amino terminal domain contains up to 6 copies of detectable ankyrin repeat (PF00023). Most TRPs are relatively non-selective. They may be modulated by voltage changes but channel gating is generally effected by other means." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB] comment: Category=family. xref: PIRSF:PIRSF038527 is_a: PR:000000001 ! protein [Term] id: PR:000000682 name: voltage-gated potassium channel alpha subunit with PAS domain def: "A protein with amino- and carboxyl-terminal intracellular domains separated by a domain (common with other ion channels) containing six transmembrane helices (S1-S6) in which the last two helices (S5 and S6) flank a loop, called the pore loop, which determines ion selectivity. Unique to this class is the presence of an N-terminal PAS fold domain (PF00989). In addition, in the cytoplasmic region downstream from S6, there is a segment that shares substantial similarity to the Cyclic nucleotide-binding domain (PF00027) (CNBD) present in cyclic nucleotide-gated cation channel subunits (PR:000000674 and PR:000000674). These channels regulate membrane excitability." [PMID:8159766] comment: Category=family. xref: PIRSF:PIRSF038287 is_a: PR:000000001 ! protein [Term] id: PR:000000683 name: voltage-gated potassium channel alpha subunit KCNA4 def: "A protein voltage-gated potassium channel alpha subunit that is a translation product of the KCNA4 gene or a 1:1 ortholog thereof. The Kv1.4 channel is a fast-inactivating channel involved in neuronal after hypolarization. It can coassemble with other Kv1 subunits. It is closely related to members of the shaker-related voltage-gated potassium channel, but has a unique N-terminal domain, with two tandem inactivation domains (ID1-ID2). ID1 may work as a pore-occluding ball domain, whereas ID2 most likely acts as a docking domain that attaches ID1 to the cytoplasmic face of the channel." [PMID:12590144] comment: Category=gene. synonym: "KCNA4" EXACT PRO-short-label [] synonym: "HPCN2" EXACT [] synonym: "voltage-gated K(+) channel HuKII" EXACT [] synonym: "voltage-gated potassium channel HBK4" EXACT [] synonym: "voltage-gated potassium channel HK1" EXACT [] synonym: "voltage-gated potassium channel subunit Kv1.4" EXACT [] synonym: "KCNA4L" RELATED [] xref: PIRSF:PIRSF038521 is_a: PR:000000001 ! protein [Term] id: PR:000000684 name: voltage-gated potassium channel subunit KQT def: "A protein with a core domain composition consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. The charged S4 segment with a basic amino acid at every third position confers their voltage sensitivity. Unlike other voltage-gated potassium channels, these proteins lack the N-terminal tetramerization domain (T1), which encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. Also, unique to this class is the presence of a carboxyl terminal domain called the KCNQ voltage-gated potassium channel domain (PF03520) or A-domain. Voltage-gated potassium channels are composed of tetramers of alpha subunits, with each alpha subunit containing a voltage sensor and contributing to the central pore. This pore is formed by these subunits that encircle a central ion conduction pathway. KQT channels are responsible for M-type potassium currents in the nervous and auditory systems and slow delayed rectifier K+ currents in the heart." [PRO:CNA] comment: Category=family. xref: PIRSF:PIRSF038513 is_a: PR:000000001 ! protein [Term] id: PR:000000685 name: voltage-gated potassium channel alpha subunit def: "A protein with a core domain composition consisting of six transmembrane domains (S1-S6), arranged in a voltage sensor (S1-S4) and pore modules (S5-P-S6), and with both N and C termini on the intracellular side of the membrane. The charged S4 segment with a basic amino acid at every third position confers their voltage sensitivity. A hallmark of this class is the presence of an N-terminal K+ channel tetramerisation domain (PF02214) (T1), which encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. Carbonyl oxygen atoms from the potassium channel signature sequence (TTxGYGD) line the selectivity filter, where they preferentially coordinate potassium. Voltage-gated potassium channels are composed of tetramers of alpha subunits with each alpha subunit containing a voltage sensor and contributing to the central pore. This pore is formed by these subunits that encircle a central ion conduction pathway." [PMID:16382097, PMID:17606609, PMID:9886290] comment: Category=family. xref: PIRSF:PIRSF002449 is_a: PR:000000001 ! protein [Term] id: PR:000000686 name: cGMP-gated cation channel alpha-1 def: "A cyclic nucleotide-gated channel alpha subunit that is a translation product of the CNGA1 gene or a 1:1 ortholog thereof. In the retina, these proteins can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors." [PRO:CNA] comment: Category=gene. synonym: "CNGA1" EXACT PRO-short-label [] synonym: "CNG channel alpha-1" EXACT [] synonym: "CNG-1" EXACT [] synonym: "CNG1" EXACT [] synonym: "cyclic nucleotide-gated cation channel 1" EXACT [] synonym: "cyclic nucleotide-gated channel alpha-1" EXACT [] synonym: "cyclic nucleotide-gated channel, photoreceptor" EXACT [] synonym: "rod photoreceptor cGMP-gated channel subunit alpha" EXACT [] synonym: "CNCG" RELATED [] synonym: "CNCG1" RELATED [] is_a: PR:000000673 ! cyclic nucleotide-gated channel alpha subunit [Term] id: PR:000000687 name: calcium-selective transient receptor potential cation channel TRPV def: "A transient receptor potential cation channel TRPV that is distinctive in being insensitive to heat and strongly selective for calcium ion transport." [PMID:16382100, PMID:16460286, PMID:17579562, PRO:WCB] comment: Category=family. xref: PIRSF:PIRSF500996 is_a: PR:000000681 ! transient receptor potential cation channel TRPV [Term] id: PR:000000688 name: cation channel sperm-associated protein 1 isoform 1 def: "A cation channel sperm-associated protein 1 that is a translation product of a mature transcript of the CATSPER1 gene encoding all core domains. Represented by the sequence UniProtKB:Q91ZR5-1." [PRO:CNA] comment: Category=sequence. synonym: "CATSPER1/iso:1" EXACT PRO-short-label [] is_a: PR:000000669 ! cation channel sperm-associated protein 1 [Term] id: PR:000000689 name: cation channel sperm-associated protein 2 isoform 1 def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene, with the core domain architecture. Represented by the sequence UniProtKB:Q96P56-1." [PRO:CNA] comment: Category=sequence. synonym: "CATSPER2/iso:1" EXACT PRO-short-label [] is_a: PR:000000670 ! cation channel sperm-associated protein 2 [Term] id: PR:000000690 name: cation channel sperm-associated protein 2 isoform 2 def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene, with all core domains, uses an alternate in-frame splice site in the coding region, compared to variant 2, resulting in a protein that is two amino acids shorter than isoform 1 (PR:000000689) after the S6 segment. Represented by the sequence UniProtKB:Q96P56-2." [PRO:CNA] comment: Category=sequence. synonym: "CATSPER2/iso:2" EXACT PRO-short-label [] is_a: PR:000000670 ! cation channel sperm-associated protein 2 [Term] id: PR:000000691 name: cation channel sperm-associated protein 2 isoform 3 def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene which uses an alternate splice site in the coding region that causes a frameshift. This form lacks most of the cytoplasmic C-terminal domain. Represented by the sequence UniProtKB:Q96P56-3." [PRO:CNA] comment: Category=sequence. synonym: "CATSPER2/iso:3" EXACT PRO-short-label [] is_a: PR:000000670 ! cation channel sperm-associated protein 2 [Term] id: PR:000000692 name: cation channel sperm-associated protein 2 isoform 4 def: "A cation channel sperm-associated protein 2 that is a translation product of the mature transcript of CATSPER2 gene, with the core domain architecture, and with an additional unconventional leucine zipper motif at the C-terminus. Represented by the sequence UniProtKB:A2ARP9-1." [PRO:CNA] comment: Category=sequence. synonym: "CATSPER2/iso:4" EXACT PRO-short-label [] is_a: PR:000000670 ! cation channel sperm-associated protein 2 [Term] id: PR:000000693 name: cation channel sperm-associated protein 3 isoform 1 def: "A cation channel sperm-associated protein 3 that is a translation product of the mature transcript of CATSPER3 gene, with the core domain architecture. Represented by the sequence UniProtKB:Q80W99-1." [PRO:CNA] comment: Category=sequence. synonym: "CATSPER3/iso:1" EXACT PRO-short-label [] is_a: PR:000000671 ! cation channel sperm-associated protein 3 [Term] id: PR:000000694 name: cation channel sperm-associated protein 3 isoform 2 def: "A cation channel sperm-associated protein 3 that is a translation product of the mature transcript of CATSPER3 gene, missing the exon coding for the C-terminal part of the first loop and most of the predicted transmembrane S2 segment. Represented by the sequence UniProtKB:Q80W99-2." [PRO:CNA] comment: Category=sequence. synonym: "CATSPER3/iso:2" EXACT PRO-short-label [] is_a: PR:000000671 ! cation channel sperm-associated protein 3 [Term] id: PR:000000695 name: cation channel sperm-associated protein subunit beta isoform 1 def: "A cation channel sperm-associated protein subunit beta that is a translation product of a mature transcript of the CASPERB gene, and that includes the putative transmembrane domains. Represented by the sequence UniProtKB:Q9H7T0-1." [PRO:CNA] comment: Category=sequence. synonym: "CATSPERB/iso:1" EXACT PRO-short-label [] is_a: PR:000000672 ! cation channel sperm-associated protein subunit beta [Term] id: PR:000000696 name: cyclic nucleotide-gated cation channel alpha-3 def: "A cyclic nucleotide-gated channel alpha subunit that is a translation product of the CNGA3 gene or a 1:1 ortholog thereof. This protein are the alpha subunits of the cone cyclic nucleotide-gated cation channel. This channel generates the light-evoked electrical responses of cone photoreceptors." [PRO:CNA] comment: Category=gene. synonym: "CNGA3" EXACT PRO-short-label [] synonym: "CNG channel alpha-3" EXACT [] synonym: "CNG-3" EXACT [] synonym: "CNG3" EXACT [] synonym: "cone photoreceptor cGMP-gated channel subunit alpha" EXACT [] synonym: "cyclic nucleotide-gated channel alpha-3" EXACT [] synonym: "CNCG3" RELATED [] is_a: PR:000000673 ! cyclic nucleotide-gated channel alpha subunit [Term] id: PR:000000697 name: cyclic nucleotide-gated cation channel beta-3 def: "A cyclic nucleotide-gated channel beta subunit that is a translation product of the CNGB3 gene or a 1:1 ortholog thereof. Many members of this class are subunits of the cone cyclic nucleotide-gated cation channel, which generates the light-evoked electrical responses of cone photoreceptors." [PRO:CNA] comment: Category=gene. synonym: "CNGB3" EXACT PRO-short-label [] synonym: "CNG channel beta-3" EXACT [] synonym: "cone photoreceptor cGMP-gated channel subunit beta" EXACT [] synonym: "cyclic nucleotide-gated channel beta-3" EXACT [] synonym: "cyclic nucleotide-gated channel subunit CNG6" EXACT [] synonym: "Cng6" RELATED [] synonym: "cyclic nucleotide-gated cation channel modulatory subunit" BROAD [] xref: PIRSF:PIRSF501006 is_a: PR:000000674 ! cyclic nucleotide-gated channel beta subunit [Term] id: PR:000000698 name: cyclic nucleotide-gated olfactory channel def: "A cyclic nucleotide-gated channel alpha subunit that is a translation product of the CNGA2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "CNGA2" EXACT PRO-short-label [] synonym: "CNG channel alpha-2" EXACT [] synonym: "CNG-2" EXACT [] synonym: "CNG2" EXACT [] synonym: "cyclic nucleotide-gated cation channel 2" EXACT [] synonym: "cyclic nucleotide-gated channel alpha-2" EXACT [] synonym: "CNCA" RELATED [] synonym: "CNCA1" RELATED [] synonym: "CNCG2" RELATED [] synonym: "Cncg4" RELATED [] is_a: PR:000000673 ! cyclic nucleotide-gated channel alpha subunit [Term] id: PR:000000699 name: transient receptor potential cation channel TRPA1 def: "A transient receptor potential cation channel TRP that is a translation product of the TRPA1 gene or a 1:1 ortholog thereof." [PRO:HJD] comment: Category=gene. synonym: "TRPA1" EXACT PRO-short-label [] synonym: "ankyrin-like with transmembrane domains protein 1" EXACT [] synonym: "transformation-sensitive protein p120" EXACT [] synonym: "ANKTM1" RELATED [] is_a: PR:000000679 ! transient receptor potential cation channel TRPA [Term] id: PR:000000700 name: intermediate conductance calcium-activated potassium channel protein 4 def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN4 gene or a 1:1 ortholog thereof. It forms a voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization which promotes calcium influx. The channel is blocked by clotrimazole and charybdotoxin but is insensitive to apamin. This feature distinguishes the intermediate from the small conductance channels." [PMID:9326665, PMID:9407042] comment: Category=gene. synonym: "KCNN4" EXACT PRO-short-label [] synonym: "IK1" EXACT [] synonym: "IKCa1" EXACT [] synonym: "KCa3.1" EXACT [] synonym: "KCa4" EXACT [] synonym: "putative Gardos channel" EXACT [] synonym: "SK4" EXACT [] synonym: "SKCa 4" EXACT [] synonym: "SKCa4" EXACT [] is_a: PR:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit [Term] id: PR:000000701 name: modulatory voltage-gated potassium channel subunit KCNG def: "A voltage-gated potassium channel alpha subunit that is a modulator of the shab-related potassium channels (Kv2). Similarly to KCNF1, KCNV and KCNS subunits, KCNG subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PxT. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits." [PMID:9305895] comment: Category=family. synonym: "silent subunit" RELATED [] xref: PIRSF:PIRSF500980 is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000702 name: modulatory voltage-gated potassium channel subunit KCNS def: "A voltage-gated potassium channel alpha subunit that is a modulator of the shab-related potassium channels (Kv2). Similarly to KCNF1, KCNV and KCNG subunits, KCNS subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PIT. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits." [PMID:12642579, PMID:9305895] comment: Category=family. synonym: "silent subunit" RELATED [] xref: PIRSF:PIRSF500981 is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000703 name: platelet-derived growth factor C def: "A platelet-derived growth factor with CUB domain that is a translation product of the PDGFC gene or a 1:1 ortholog thereof. Potent mitogen and chemoattractant for cells of mesenchymal origin. Binding of this growth factor to its affinity receptor elicits a variety of cellular responses. Appears to be involved in the three stages of wound healing: inflammation, proliferation and remodeling." [PRO:CNA] comment: Category=gene. synonym: "PDGFC" EXACT PRO-short-label [] synonym: "fallotein" EXACT [] synonym: "PDGF-C" EXACT [] synonym: "SCDGF" EXACT [] synonym: "spinal cord-derived growth factor" EXACT [] synonym: "VEGF-E" EXACT [] is_a: PR:000000675 ! platelet-derived growth factor with CUB domain [Term] id: PR:000000704 name: platelet-derived growth factor D def: "A platelet-derived growth factor with CUB domain that is a translation product of the PDGFD gene or a 1:1 ortholog thereof. Potent mitogen for cells of mesenchymal origin." [PRO:CNA] comment: Category=gene. synonym: "PDGFD" EXACT PRO-short-label [] synonym: "Iris-expressed growth factor" EXACT [DNx] synonym: "PDGF-D" EXACT [] synonym: "SCDGF-B" EXACT [] synonym: "spinal cord-derived growth factor B" EXACT [] synonym: "IEGF" RELATED [] synonym: "SCDGFB" RELATED [] is_a: PR:000000675 ! platelet-derived growth factor with CUB domain [Term] id: PR:000000705 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "HCN1" EXACT PRO-short-label [] synonym: "BCNG-1" EXACT [] synonym: "brain cyclic nucleotide-gated channel 1" EXACT [] synonym: "HAC-2" EXACT [] synonym: "hyperpolarization-activated cation channel 2" EXACT [] synonym: "BCNG1" RELATED [] synonym: "Hac2" RELATED [] is_a: PR:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein [Term] id: PR:000000706 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "HCN2" EXACT PRO-short-label [] synonym: "BCNG-2" EXACT [] synonym: "brain cyclic nucleotide-gated channel 2" EXACT [] synonym: "HAC-1" EXACT [] synonym: "hyperpolarization-activated cation channel 1" EXACT [] synonym: "BCNG2" RELATED [] synonym: "Hac1" RELATED [] xref: PIRSF:PIRSF500961 is_a: PR:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein [Term] id: PR:000000707 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "HCN3" EXACT PRO-short-label [] synonym: "HAC-3" EXACT [] synonym: "hyperpolarization-activated cation channel 3" EXACT [] synonym: "Hac3" RELATED [] synonym: "KIAA1535" RELATED [] xref: PIRSF:PIRSF500962 is_a: PR:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein [Term] id: PR:000000708 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein that is a translation product of the HCN4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "HCN4" EXACT PRO-short-label [] synonym: "BCNG-3" EXACT [] synonym: "brain cyclic nucleotide-gated channel 3" EXACT [] synonym: "Bcng3" RELATED [] xref: PIRSF:PIRSF500963 is_a: PR:000000676 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel protein [Term] id: PR:000000709 name: shaker-related voltage-gated potassium channel alpha subunit def: "A voltage-gated potassium channel alpha subunit that is a member of the subfamily A of voltage-gated potassium channels. The N-terminus is rich in basic residues and this region is critical for the N-type inactivation. Shaker-related voltage-gated potassium channels (Kv1 channels) play an important role in modulating electrical excitability of axons." [PMID:11506885] comment: Category=family. synonym: "Kv1" RELATED [] is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000710 name: shal-related voltage-gated potassium channel def: "A voltage-gated potassium channel alpha subunit that is a constituent of the Kv4 channels, responsible for transient, voltage-dependent potassium currents (A currents) in the brain and heart. The unique motif KSCASE is absolutely conserved in all shal-related channel subunits. Mutations in this region drastically affect deactivation and inactivation. This motif is located in the cytoplasmic S4-S5 loop. In common with Kv2 and Kv3 channels, the tetramerization domain at the N-terminus contains a zinc binding site. Kv.4 channels are modulated by Kv4 Channel Interacting Proteins (KChIPs1-4), which bind to the cytoplasmic N-terminal domain." [PMID:15555915] comment: Category=family. synonym: "A-type potassium channel" RELATED [] synonym: "Kv4" RELATED [] synonym: "pore-forming Kv4 alpha subunits" RELATED [] xref: PIRSF:PIRSF500983 is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000711 name: shaw-related voltage-gated potassium channel alpha subunit def: "A voltage-gated potassium channel alpha subunit that is a constituent of Kv3 channels. These proteins are characterized by the high sequence conservation in the S5 segment which seems to determine the gating properties of the Kv3 channels: rightward shifted voltage dependence and fast deactivation rates. They also contain an ATM motif at the lysine-rich C-terminal region that is unique to this group. Kv3 channels are necessary for high-frequency, repetitive firing of action potentials. High activation threshold is a hallmark of Kv3 channels. They regulate rapid spiking, transmitter release and dendritic integration of many central neurons. In common with Kv2 and Kv4 channels, the tetramerization domain at the N-terminus contains a zinc-binding site." [PMID:11506885] comment: Category=family. synonym: "Kv3 channel" RELATED [] xref: PIRSF:PIRSF500973 is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000712 name: small conductance calcium-activated potassium channel protein 1 def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNN1" EXACT PRO-short-label [] synonym: "SKCa 1" EXACT [] synonym: "SKCa1" EXACT [] synonym: "SK" RELATED [] synonym: "SK1" RELATED [] is_a: PR:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit [Term] id: PR:000000713 name: small conductance calcium-activated potassium channel protein 2 def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNN2" EXACT PRO-short-label [] synonym: "SKCa 2" EXACT [] synonym: "SKCa2" EXACT [] synonym: "SK2" RELATED [] is_a: PR:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit [Term] id: PR:000000714 name: small conductance calcium-activated potassium channel protein 3 def: "A calcium-activated calmodulin-binding potassium channel alpha subunit that is a translation product of the KCNN3 gene or a 1:1 ortholog thereof. The KCNN3 gene contains two arrays of CAG trinucleotide repeats, which are highly polymorphic. The SK3 channels are thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization." [PRO:CNA] comment: Category=gene. synonym: "KCNN3" EXACT PRO-short-label [] synonym: "SK3" EXACT [] synonym: "SKCa 3" EXACT [] synonym: "SKCa3" EXACT [] synonym: "K3" RELATED [] is_a: PR:000000668 ! calcium-activated calmodulin-binding potassium channel alpha subunit [Term] id: PR:000000715 name: sodium leak channel non-selective protein isoform 1 def: "A sodium leak channel non-selective protein that is a translation product of a mature transcript of the NALCN gene, and that contains the four copies of the 6 transmembrane ion transport protein domain. Represented by the sequence UniProtKB:Q8IZF0-1. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability." [PRO:CNA] comment: Category=sequence. synonym: "NALCN/iso:1" EXACT PRO-short-label [] is_a: PR:000000678 ! sodium leak channel non-selective protein [Term] id: PR:000000716 name: sodium leak channel non-selective protein isoform 2 def: "A Sodium leak channel non-selective protein that is a translation product of a mature transcript of the NALCN gene, and that lacks three of the six transmembrane ion transport domain at the C-terminus. Represented by the sequence UniProtKB:Q8IZF0-2." [PRO:CNA] comment: Category=sequence. synonym: "NALCN/iso:2" EXACT PRO-short-label [] is_a: PR:000000678 ! sodium leak channel non-selective protein [Term] id: PR:000000717 name: sodium leak channel non-selective protein isoform 3 def: "A sodium leak channel non-selective protein that is a translation product of a mature transcript of the NALCN gene, and that contains only a partial copy of the most N-terminal transmembrane ion transport domain. Represented by the sequence UniProtKB:Q8IZF0-3." [PRO:CNA] comment: Category=sequence. synonym: "NALCN/iso:3" EXACT PRO-short-label [] synonym: "sodium leak channel non-selective protein isoform 4" EXACT [] is_a: PR:000000678 ! sodium leak channel non-selective protein [Term] id: PR:000000718 name: transient receptor potential cation channel TRPC3/6/7 def: "A transient receptor potential cation channel TRPC that is a member of a subgroup of subfamily C containing the very similar TRPC3, TRPC6, and TRPC7. They form homomeric or heteromeric nonselective cation channels that generate double-rectifying currents and are activated by diacylglycerol." [PMID:16382100, PMID:16460286, PMID:17579562] comment: Category=family. synonym: "DAG-sensitive TRPC" RELATED [] xref: PIRSF:PIRSF500999 is_a: PR:000000680 ! transient receptor potential cation channel TRPC [Term] id: PR:000000719 name: voltage-gated potassium channel Eag alpha subunit def: "A voltage-gated potassium channel alpha subunit with PAS domain whose activation is characterized by a nonsuperimposable Cole-Moore shift, in which the time course of activation becomes slower and more sigmoidal as the prepulse or holding potential is made more negative and, as a consequence, the currents do not superimpose when aligned by shifting along the time axis." [PMID:10191308, PMID:6275922] comment: Category=family. xref: PIRSF:PIRSF500995 is_a: PR:000000682 ! voltage-gated potassium channel alpha subunit with PAS domain [Term] id: PR:000000720 name: voltage-gated potassium channel Elk alpha subunit comment: Category=family. xref: PIRSF:PIRSF500884 is_a: PR:000000682 ! voltage-gated potassium channel alpha subunit with PAS domain [Term] id: PR:000000721 name: voltage-gated potassium channel Erg alpha subunit def: "A voltage-gated potassium channel alpha subunit with PAS domain which is characterized by its nanomolar sensitivity to class III antiarrhythmic drugs." [PMID:7604285] comment: Category=family. xref: PIRSF:PIRSF500886 is_a: PR:000000682 ! voltage-gated potassium channel alpha subunit with PAS domain [Term] id: PR:000000722 name: voltage-gated potassium channel KCNB1 def: "A shab-related voltage-gated potassium channel alpha subunit that is a translation product of the KCNB1 gene or a 1:1 ortholog thereof. It associates with other subunits to generate a delayed rectifier potassium channel." [PRO:CNA] comment: Category=gene. synonym: "KCNB1" EXACT PRO-short-label [] synonym: "delayed rectifier potassium channel 1" EXACT [] synonym: "DRK1" EXACT [] synonym: "h-DRK1" EXACT [] synonym: "mShab" EXACT [] synonym: "voltage-gated potassium channel subunit Kv2.1" EXACT [] is_a: PR:000000677 ! shab-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000723 name: voltage-gated potassium channel KCNB2 def: "A shab-related voltage-gated potassium channel alpha subunit that is a translation product of the KCNB2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNB2" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv2.2" EXACT [] is_a: PR:000000677 ! shab-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000724 name: voltage-gated potassium channel KCNF1 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNF1 gene or a 1:1 ortholog thereof. KCNF1 is a modulator of the shab-related potassium channels (Kv2). Unlike other potassium channel subunits, KCNF1 subunits are not able to form functional channels on their own." [PMID:9696692] comment: Category=gene. synonym: "KCNF1" EXACT PRO-short-label [] synonym: "kH1" EXACT [] synonym: "voltage-gated potassium channel subunit Kv5.1" EXACT [] xref: PIRSF:PIRSF500982 is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000725 name: voltage-gated potassium channel KCNV1 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNV1 gene or a 1:1 ortholog thereof. It has an atypical S6 segment containing the structural elements that modify inactivation of Kv2 channels. Similarly to KCNF1, KCNV1 and KCNS, KCNV2 subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PIA. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits. It modulates the activity of KCNB1 and KCNB2 channels by changing kinetics and levels of expression and by shifting the half-inactivation potential to more polarized values." [PMID:16382104] comment: Category=gene. synonym: "KCNV1" EXACT PRO-short-label [] synonym: "neuronal potassium channel alpha subunit HNKA" EXACT [] synonym: "voltage-gated potassium channel subunit Kv8.1" EXACT [] xref: PANTHER:PTHR11537\:SF38 is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000726 name: voltage-gated potassium channel KCNV2 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNV2 gene or a 1:1 ortholog thereof. Similarly to KCNF1, KCNV1 and KCNS, KCNV2 subunits are not able to form functional channels on their own. Also in common with these modulatory subunits, it lacks the conserved PxP motif located in the distal part of S6. In this class the motif is PIS. The alteration of the PxP motif seems to be an important determinant of the regulatory function of modulatory subunits." [PRO:CNA] comment: Category=gene. synonym: "KCNV2" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv8.2" EXACT [] xref: PANTHER:PTHR11537\:SF40 is_a: PR:000000685 ! voltage-gated potassium channel alpha subunit [Term] id: PR:000000727 name: voltage-gated potassium channel alpha subunit KCNA4 isoform 1 def: "A voltage-gated potassium channel alpha subunit KCNA4 that is a translation product of a mature transcript of the KCNA4 gene, and that includes the potassium channel alpha subunit core domains. Represented by the sequence UniProtKB:Q8CBF8-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNA4/iso:1" EXACT PRO-short-label [] is_a: PR:000000683 ! voltage-gated potassium channel alpha subunit KCNA4 [Term] id: PR:000000728 name: voltage-gated potassium channel subunit KCNQ1 def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNQ1" EXACT PRO-short-label [] synonym: "IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1" EXACT [] synonym: "KQT-like 1" EXACT [] synonym: "voltage-gated potassium channel subunit Kv7.1" EXACT [] synonym: "KCNA8" RELATED [] synonym: "KCNA9" RELATED [] synonym: "KVLQT1" RELATED [] xref: PIRSF:PIRSF500964 is_a: PR:000000684 ! voltage-gated potassium channel subunit KQT [Term] id: PR:000000729 name: voltage-gated potassium channel subunit KCNQ2 def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ2 gene or a 1:1 ortholog thereof. Most of the isoforms are generated by splicing that is restricted to a region that encodes the intracellular C-terminal domain of the channel (exons 7-16 in rat). From these, there are two main classes, one containing exon 16 in-frame, and others with an alternative splice junction in exon 14 that results in a frameshift and early termination. In addition, exons 12 and 13 have alternative splice junctions, and exons 8,11, and 15a are subject to splicing. Many members of this class can form heteromeric channels with members of the class KCNQ3 (PR:000000730). Some forms of KCNQ2 contain two binding calmodulin binding sites and calmodulin is tethered constitutively to KCNQ channels." [PMID:11230508, PMID:12223552] comment: Category=gene. synonym: "KCNQ2" EXACT PRO-short-label [] synonym: "KQT-like 2" EXACT [] synonym: "neuroblastoma-specific potassium channel subunit alpha KvLQT2" EXACT [] synonym: "potassium channel subunit alpha KvLQT2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv7.2" EXACT [] synonym: "Kqt2" RELATED [] xref: PIRSF:PIRSF500965 is_a: PR:000000684 ! voltage-gated potassium channel subunit KQT [Term] id: PR:000000730 name: voltage-gated potassium channel subunit KCNQ3 def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ3 gene or a 1:1 ortholog thereof. Many members of this class can form heteromeric channels with members of the class KCNQ2 (PR:000000729) or KCNQ5 with essentially identical properties to the channel underlying the native M-current." [PMID:10479678] comment: Category=gene. synonym: "KCNQ3" EXACT PRO-short-label [] synonym: "KQT-like 3" EXACT [] synonym: "potassium channel subunit alpha KvLQT3" EXACT [] synonym: "voltage-gated potassium channel subunit Kv7.3" EXACT [] xref: PIRSF:PIRSF500966 is_a: PR:000000684 ! voltage-gated potassium channel subunit KQT [Term] id: PR:000000731 name: voltage-gated potassium channel subunit KCNQ4 def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNQ4" EXACT PRO-short-label [] synonym: "KQT-like 4" EXACT [] synonym: "potassium channel subunit alpha KvLQT4" EXACT [] synonym: "voltage-gated potassium channel subunit Kv7.4" EXACT [] xref: PANTHER:PTHR11537\:SF4 xref: PIRSF:PIRSF500967 is_a: PR:000000684 ! voltage-gated potassium channel subunit KQT [Term] id: PR:000000732 name: voltage-gated potassium channel subunit KCNQ5 def: "A voltage-gated potassium channel subunit KQT that is a translation product of the KCNQ5 gene or a 1:1 ortholog thereof. It contributes to M-type potassium currents. It is also inhibited by M1 muscarinic receptor activation." [PRO:CNA] comment: Category=gene. synonym: "KCNQ5" EXACT PRO-short-label [] synonym: "KQT-like 5" EXACT [] synonym: "potassium channel subunit alpha KvLQT5" EXACT [] synonym: "voltage-gated potassium channel subunit Kv7.5" EXACT [] xref: PIRSF:PIRSF500968 is_a: PR:000000684 ! voltage-gated potassium channel subunit KQT [Term] id: PR:000000737 name: cGMP-gated cation channel alpha-1 isoform 1 def: "A cGMP-gated cation channel alpha-1 that is a translation product of a mature transcript of the CNGA1 gene encoding all core domains. Represented by the sequence UniProtKB:P29973-1." [PRO:CNA] comment: Category=sequence. synonym: "CNGA1/iso:1" EXACT PRO-short-label [] is_a: PR:000000686 ! cGMP-gated cation channel alpha-1 [Term] id: PR:000000738 name: cGMP-gated cation channel alpha-1 sequence variant 1 def: "A cGMP-gated cation channel alpha-1 that has a Phe residue at the position equivalent to Ser-316 in the human sequence UniProtKB:P29973-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000686 ! cGMP-gated cation channel alpha-1 [Term] id: PR:000000739 name: cyclic nucleotide-gated cation channel alpha-3 isoform 1 def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a mature transcript of the CNGA3 gene, and that includes all core domains, and the N-terminal region coded by exons 3 and 5. Represented by the sequence UniProtKB:Q16281-1. Exon nomenclature from PMID:8922401 and 10813773." [PRO:CNA] comment: Category=sequence. synonym: "CNGA3/iso:1" EXACT PRO-short-label [] is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000740 name: cyclic nucleotide-gated cation channel alpha-3 isoform 2 def: "A cyclic nucleotide-gated cation channel alpha-3 that is a translation product of a mature transcript of the CNGA3 gene, and that includes all core domains, but lacks the N-terminal region coded by exons 3, 5 and 6. Represented by the sequence UniProtKB:Q9JJZ8-1 . Exon nomenclature from PMID:8922401 and 10813773." [PMID:10813773] comment: Category=sequence. synonym: "CNGA3/iso:2" EXACT PRO-short-label [] is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000741 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 1 def: "A cyclic nucleotide-gated cation channel alpha-3 that has a Gln residue at the position equivalent to Arg-283 in the human sequence UniProtKB:Q16281-1. This residue is located within the segment S4." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000742 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 2 def: "A cyclic nucleotide-gated cation channel alpha-3 that has an Arg residue at the position equivalent to Thr-291 in the human sequence UniProtKB:Q16281-1. This residue is located within the segment S4." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000743 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 3 def: "A cyclic nucleotide-gated cation channel alpha-3 that has an Arg residue at the position equivalent to Gly-557 in the human sequence UniProtKB:Q16281-1. This residue is located within the cytoplasmic cyclic nucleotide binding domain (CNBD)." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000744 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 4 def: "A cyclic nucleotide-gated cation channel alpha-3 that has a Met residue at the position equivalent to Val-529 in the human sequence UniProtKB:Q16281-1. This residue is located within the cytoplasmic cyclic nucleotide binding domain (CNBD)." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000745 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 5 def: "A cyclic nucleotide-gated cation channel alpha-3 that has a Trp residue at the position equivalent to Arg-283 in the human sequence UniProtKB:Q16281-1. This residue is located within the segment S4." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000746 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 6 def: "A cyclic nucleotide-gated cation channel alpha-3 that has a Leu residue at the position equivalent to Phe-547 in the human sequence UniProtKB:Q16281-1. This residue is located within the cytoplasmic cyclic nucleotide binding domain (CNBD)." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000747 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 7 def: "A cyclic nucleotide-gated cation channel alpha-3 that has a Trp residue at the position equivalent to Arg-410 in the human sequence UniProtKB:Q16281-1. This residue is located at the cytoplasmic C-terminus." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000748 name: cyclic nucleotide-gated cation channel alpha-3 sequence variant 8 def: "A cyclic nucleotide-gated cation channel alpha-3 that has a Leu residue at the position equivalent to Pro-163 in the human sequence UniProtKB:Q16281-1." [PMID:9662398] comment: Category=sequence. is_a: PR:000000696 ! cyclic nucleotide-gated cation channel alpha-3 [Term] id: PR:000000749 name: cyclic nucleotide-gated cation channel beta-3 isoform 1 def: "A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, and that contains the core domains but lacks the C-terminal region after the cyclic nucleotide binding domain (CNBD). Represented by the sequence UniProtKB:Q9JJZ9-1." [PRO:CNA] comment: Category=sequence. synonym: "CNGB3/iso:1" EXACT PRO-short-label [] is_a: PR:000000697 ! cyclic nucleotide-gated cation channel beta-3 [Term] id: PR:000000750 name: cyclic nucleotide-gated cation channel beta-3 isoform 2 def: "A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, and that contains the core domains and the extended C-terminal region after the cyclic nucleotide binding domain (CNBD), but with five missing residues within this domain as compared to isoform 3. Represented by the sequence UniProtKB:Q9NQW8-2." [PMID:10888875] comment: Category=sequence. synonym: "CNGB3/iso:2" EXACT PRO-short-label [] is_a: PR:000000697 ! cyclic nucleotide-gated cation channel beta-3 [Term] id: PR:000000751 name: cyclic nucleotide-gated cation channel beta-3 isoform 3 def: "A cyclic nucleotide-gated cation channel beta-3 that is a translation product of a mature transcript of the CNGB3 gene, and that contains the core domains and the extended C-terminal region after the cyclic nucleotide binding domain (CNBD). Represented by the sequence UniProtKB:Q9NQW8-1." [PMID:10958649] comment: Category=sequence. synonym: "CNGB3/iso:3" EXACT PRO-short-label [] is_a: PR:000000697 ! cyclic nucleotide-gated cation channel beta-3 [Term] id: PR:000000752 name: cyclic nucleotide-gated cation channel beta-3 sequence variant 1 def: "A cyclic nucleotide-gated cation channel beta-3 that has a Phe residue at the position equivalent to Ser-435 in the human sequence UniProtKB:Q9NQW8-1." [PMID:10958649] comment: Category=sequence. is_a: PR:000000697 ! cyclic nucleotide-gated cation channel beta-3 [Term] id: PR:000000753 name: intermediate conductance calcium-activated potassium channel protein 4 isoform 1 def: "An intermediate conductance calcium-activated potassium channel protein 4 that is a translation product of a mature transcript of the KCNN4 gene. It contains all core domains. Represented by the sequence UniProtKB:O15554-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNN4/iso:1" EXACT PRO-short-label [] is_a: PR:000000700 ! intermediate conductance calcium-activated potassium channel protein 4 [Term] id: PR:000000754 name: platelet-derived growth factor C isoform 1 def: "A platelet-derived growth factor C that is a translation product of a mature transcript of the PDGFC gene, and that includes the core domains. Represented by the sequence UniProtKB:Q9NRA1-1. This form is the precursor." [PRO:CNA] comment: Category=sequence. synonym: "PDGFC/iso:1" EXACT PRO-short-label [] is_a: PR:000000703 ! platelet-derived growth factor C [Term] id: PR:000000755 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN1 gene encoding all core domains. Represented by the sequence UniProtKB:O88704-1." [PRO:CNA] comment: Category=sequence. synonym: "HCN1/iso:1" EXACT PRO-short-label [] is_a: PR:000000705 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 [Term] id: PR:000000756 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN2 gene encoding all core domains. Represented by the sequence UniProtKB:O88703-1." [PRO:CNA] comment: Category=sequence. synonym: "HCN2/iso:1" EXACT PRO-short-label [] synonym: "potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1" EXACT [] is_a: PR:000000706 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Term] id: PR:000000757 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 isoform 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN3 gene encoding all core domains. Represented by the sequence UniProtKB:O88705-1." [PRO:CNA] comment: Category=sequence. synonym: "HCN3/iso:1" EXACT PRO-short-label [] is_a: PR:000000707 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 [Term] id: PR:000000758 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 isoform 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 that is a translation product of a mature transcript of the HCN4 gene encoding all core domains. Represented by the sequence UniProtKB:Q9Y3Q4-1." [PRO:CNA] comment: Category=sequence. synonym: "HCN4/iso:1" EXACT PRO-short-label [] is_a: PR:000000708 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Term] id: PR:000000759 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 sequence variant 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 that has an Asn residue at the position equivalent to Asp-553 in the human sequence UniProtKB:Q9Y3Q4-1." [PMID:15123648] comment: Category=sequence. is_a: PR:000000708 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Term] id: PR:000000760 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 sequence variant 2 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 that has an Arg residue at the position equivalent to Ser-672 in the human sequence UniProtKB:Q9Y3Q4-1. This residue is located in the CNBD." [PMID:16407510] comment: Category=sequence. is_a: PR:000000708 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Term] id: PR:000000761 name: small conductance calcium-activated potassium channel protein 1 isoform 1 def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9EQR3-1, which is produced by alternative splicing events in which various combinations of the four 5' non-coding exons A, B1, B2 or C are joined directly to exon 3.2." [PRO:CNA, UniProtKB:Q9EQR3-1] comment: Category=sequence. synonym: "KCNN1/iso:1" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000762 name: small conductance calcium-activated potassium channel protein 1 isoform 2 def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q92952-2." [PRO:CNA] comment: Category=sequence. synonym: "KCNN1/iso:2" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000763 name: small conductance calcium-activated potassium channel protein 1 isoform I def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9EQR3-2, which is produced by usage of the starting Met in exon 3.1, and includes the regions encoded by exon 7, 8, 8a and 9." [PMID:11267657] comment: Category=sequence. synonym: "KCNN1/iso:I" EXACT PRO-short-label [] synonym: "isoform I" RELATED [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000764 name: small conductance calcium-activated potassium channel protein 1 isoform II def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9EQR3-9, which lacks the region encoded by exon 9, but includes exons 7, 8 and 8a." [PMID:11267657] comment: Category=sequence. synonym: "KCNN1/iso:II" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000765 name: small conductance calcium-activated potassium channel protein 1 isoform III def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene. It includes all core domains, but it has a distinct C-terminus. Represented by the sequence UniProtKB:Q9EQR3-8, which lacks the region encoded by exons 8a, but includes exons 7 and 8 and 9." [PMID:11267657] comment: Category=sequence. synonym: "KCNN1/iso:III" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000766 name: small conductance calcium-activated potassium channel protein 1 isoform IV def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene. It includes all core domains, but it has a distinct C-terminus. Represented by the sequence UniProtKB:Q9EQR3-7, which lacks the region encoded by exons 8a and 9, but includes exons 7 and 8." [PMID:11267657] comment: Category=sequence. synonym: "KCNN1/iso:IV" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000767 name: small conductance calcium-activated potassium channel protein 1 isoform V def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene. The distal portion of the S6 transmembrane is modified in relation to isoform I due to the lack of an exon in the coding transcript. Represented by the sequence UniProtKB:Q9EQR3-3, which lacks the region encoded by exon 7, but includes exons 8, 8a and 9." [PMID:11267657] comment: Category=sequence. synonym: "KCNN1/iso:V" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000768 name: small conductance calcium-activated potassium channel protein 1 isoform VI def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9EQR3-4, which lacks the region encoded by exons 7 and 9, but includes exons 8 and 8a." [PMID:11267657, PRO:CNA] comment: Category=sequence. synonym: "KCNN1/iso:VI" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000769 name: small conductance calcium-activated potassium channel protein 1 isoform VII def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9EQR3-5, which lacks the region encoded by exons 7 and 8a, but includes exons 8 and 9." [PMID:11267657] comment: Category=sequence. synonym: "KCNN1/iso:VII" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000770 name: small conductance calcium-activated potassium channel protein 1 isoform VIII def: "A small conductance calcium-activated potassium channel protein 1 that is a translation product of a mature transcript of the KCNN1 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9EQR3-6, which lacks the region encoded by exons 7, 8a and 9, but includes exon 8." [PMID:11267657] comment: Category=sequence. synonym: "KCNN1/iso:VIII" EXACT PRO-short-label [] is_a: PR:000000712 ! small conductance calcium-activated potassium channel protein 1 [Term] id: PR:000000771 name: small conductance calcium-activated potassium channel protein 2 isoform 1 def: "A small conductance calcium-activated potassium channel protein 2 that is a translation product of a mature transcript of the KCNN2 gene, and that includes the core domains. Represented by the sequence UniProtKB:Q9H2S1-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNN2/iso:1" EXACT PRO-short-label [] is_a: PR:000000713 ! small conductance calcium-activated potassium channel protein 2 [Term] id: PR:000000772 name: small conductance calcium-activated potassium channel protein 2 isoform 2 def: "A small conductance calcium-activated potassium channel protein 2 that is a translation product of a mature transcript of the KCNN2 gene lacking the exons coding for the N-terminal cytoplasmic domain and most of the transmembrane segments of the calcium-activated SK potassium channel domain. Represented by the sequence UniProtKB:Q6PJI0-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNN2/iso:2" EXACT PRO-short-label [] is_a: PR:000000713 ! small conductance calcium-activated potassium channel protein 2 [Term] id: PR:000000773 name: small conductance calcium-activated potassium channel protein 3 isoform 1 def: "A small conductance calcium-activated potassium channel protein 3 that is a translation product of a mature transcript of the KCNN3 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9UGI6-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNN3/iso:1" EXACT PRO-short-label [] is_a: PR:000000714 ! small conductance calcium-activated potassium channel protein 3 [Term] id: PR:000000774 name: small conductance calcium-activated potassium channel protein 3 variant 1 def: "A small conductance calcium-activated potassium channel protein 3 that has a C-terminal truncation. The truncated protein lacks the transmembrane and the calmodulin binding domains. However, it conserves the two glutamine rich domains." [PMID:11395478] comment: Category=sequence. is_a: PR:000000714 ! small conductance calcium-activated potassium channel protein 3 [Term] id: PR:000000775 name: transient receptor potential cation channel TRPC3 def: "A transient receptor potential cation channel TRPC3/6/7 that is a translation product of the TRPC3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "TRPC3" EXACT PRO-short-label [] synonym: "hTrp-3" EXACT [] synonym: "hTrp3" EXACT [] synonym: "mTrp3" EXACT [] synonym: "receptor-activated cation channel TRP3" EXACT [] synonym: "transient receptor protein 3" EXACT [] synonym: "TRP-3" EXACT [] synonym: "Trp-related protein 3" EXACT [DNx] synonym: "TrpC3" EXACT [] synonym: "TRP3" RELATED [] synonym: "Trrp3" RELATED [] is_a: PR:000000718 ! transient receptor potential cation channel TRPC3/6/7 [Term] id: PR:000000776 name: transient receptor potential cation channel TRPV5 def: "A calcium-selective transient receptor potential cation channel TRPV that is a translation product of the TRPV5 gene or a 1:1 ortholog thereof." [PRO:HJD] comment: Category=gene. synonym: "TRPV5" EXACT PRO-short-label [] synonym: "calcium transport protein 2" EXACT [] synonym: "CaT2" EXACT [] synonym: "ECaC1" EXACT [] synonym: "epithelial calcium channel 1" EXACT [] synonym: "Osm-9-like TRP channel 3" EXACT [DNx] synonym: "OTRPC3" EXACT [] synonym: "TrpV5" EXACT [] is_a: PR:000000687 ! calcium-selective transient receptor potential cation channel TRPV [Term] id: PR:000000777 name: transient receptor potential cation channel TRPV6 def: "A calcium-selective transient receptor potential cation channel TRPV that is a translation product of the TRPV6 gene or a 1:1 ortholog thereof." [PRO:HJD] comment: Category=gene. synonym: "TRPV6" EXACT PRO-short-label [] synonym: "calcium transport protein 1" EXACT [] synonym: "CaT1" EXACT [] synonym: "ECaC2" EXACT [] synonym: "epithelial calcium channel 2" EXACT [] synonym: "TrpV6" EXACT [] is_a: PR:000000687 ! calcium-selective transient receptor potential cation channel TRPV [Term] id: PR:000000778 name: voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated form def: "A voltage-gated potassium channel alpha subunit KCNC4 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000727 ! voltage-gated potassium channel alpha subunit KCNA4 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000779 name: voltage-gated potassium channel KCNB1 isoform 1 def: "A voltage-gated potassium channel KCNB1 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q14721-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "KCNB1/iso:1" EXACT PRO-short-label [] is_a: PR:000000722 ! voltage-gated potassium channel KCNB1 [Term] id: PR:000000780 name: voltage-gated potassium channel KCNB2 isoform 1 def: "A voltage-gated potassium channel KCNB2 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q92953-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "KCNB2/iso:1" EXACT PRO-short-label [] is_a: PR:000000723 ! voltage-gated potassium channel KCNB2 [Term] id: PR:000000781 name: voltage-gated potassium channel KCNC1 def: "A shaw-related voltage-gated potassium channel alpha subunit that is a translation product of the KCNC1 gene or a 1:1 ortholog thereof. They contain an ATM motif at the C-terminus, following the S6 segment that allows interaction with axonal targeting machinery when exposed." [PRO:CNA] comment: Category=gene. synonym: "KCNC1" EXACT PRO-short-label [] synonym: "NGK2" EXACT [] synonym: "RAW2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv3.1" EXACT [] synonym: "voltage-gated potassium channel subunit Kv4" EXACT [] is_a: PR:000000711 ! shaw-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000782 name: voltage-gated potassium channel KCNC2 def: "A shaw-related voltage-gated potassium channel alpha subunit that is a translation product of the KCNC2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNC2" EXACT PRO-short-label [] synonym: "KSHIIIA" EXACT [] synonym: "voltage-gated potassium channel Kv3.2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv3.2" EXACT [] is_a: PR:000000711 ! shaw-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000783 name: voltage-gated potassium channel KCNC4 def: "A shaw-related voltage-gated potassium channel alpha subunit that is a translation product of the KCNC4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNC4" EXACT PRO-short-label [] synonym: "KSHIIIC" EXACT [] synonym: "voltage-gated potassium channel subunit Kv3.4" EXACT [] is_a: PR:000000711 ! shaw-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000784 name: voltage-gated potassium channel KCND1 def: "A shal-related voltage-gated potassium channel that is a translation product of the KCND1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCND1" EXACT PRO-short-label [] synonym: "mShal" EXACT [] synonym: "voltage-gated potassium channel subunit Kv4.1" EXACT [] xref: PANTHER:PTHR11537\:SF15 is_a: PR:000000710 ! shal-related voltage-gated potassium channel [Term] id: PR:000000785 name: voltage-gated potassium channel KCND2 def: "A shal-related voltage-gated potassium channel that is a translation product of the KCND2 gene or a 1:1 ortholog thereof. Kv4.2 potassium channels play a critical role in postsynaptic excitability. They are modulated by phosphorylation as well as by association with Kv4 Channel Interacting Proteins (KChIPs). The N-terminus contains an ER retention motif RKR that seems to be masked when associated to KChiPs. This masking increases surface expression." [PMID:12829703, PRO:CNA] comment: Category=gene. synonym: "KCND2" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv4.2" EXACT [] synonym: "KIAA1044" RELATED [] is_a: PR:000000710 ! shal-related voltage-gated potassium channel [Term] id: PR:000000786 name: voltage-gated potassium channel KCND3 def: "A shal-related voltage-gated potassium channel that is a translation product of the KCND3 gene or a 1:1 ortholog thereof. These subunits form homotetramers or heterotetramers with KCND1 and/or KCND2. Associates with the regulatory subunits KCNIP1, KCNIP2, KCNIP3 and KCNIP4." [PRO:CNA] comment: Category=gene. synonym: "KCND3" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv4.3" EXACT [] is_a: PR:000000710 ! shal-related voltage-gated potassium channel [Term] id: PR:000000787 name: voltage-gated potassium channel KCNG1 def: "A modulatory voltage-gated potassium channel subunit KCNG that is a translation product of the KCNG1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNG1" EXACT PRO-short-label [] synonym: "kH2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv6.1" EXACT [] is_a: PR:000000701 ! modulatory voltage-gated potassium channel subunit KCNG [Term] id: PR:000000788 name: voltage-gated potassium channel KCNG3 def: "A modulatory voltage-gated potassium channel subunit KCNG that is a translation product of the KCNG3 gene or a 1:1 ortholog thereof. It has to be associated with Kv2 subunits (PR:000000677) or possibly another partner to get inserted in the plasma membrane. Remains intracellular in the absence of KCNB1." [PRO:CNA] comment: Category=gene. synonym: "KCNG3" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv6.3" EXACT [] synonym: "voltage-gated potassium channel subunit Kv10.1" RELATED [] is_a: PR:000000701 ! modulatory voltage-gated potassium channel subunit KCNG [Term] id: PR:000000789 name: voltage-gated potassium channel KCNG4 def: "A modulatory voltage-gated potassium channel subunit KCNG that is a translation product of the KCNG4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNG4" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv6.4" EXACT [] synonym: "KCNG3" RELATED [] is_a: PR:000000701 ! modulatory voltage-gated potassium channel subunit KCNG [Term] id: PR:000000790 name: voltage-gated potassium channel KCNH1 def: "A voltage-gated potassium channel Eag alpha subunit that is a translation product of the KHCN1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KHCN1" EXACT PRO-short-label [] synonym: "EAG channel 1" EXACT [] synonym: "EAG1" EXACT [] synonym: "ether-a-go-go potassium channel 1" EXACT [] synonym: "h-eag" EXACT [] synonym: "hEAG1" EXACT [] synonym: "m-eag" EXACT [] synonym: "EAG" RELATED [] synonym: "EAG1" RELATED [] synonym: "KCNH1" RELATED [] synonym: "voltage-gated potassium channel subunit Kv10.1" RELATED [] is_a: PR:000000719 ! voltage-gated potassium channel Eag alpha subunit [Term] id: PR:000000791 name: voltage-gated potassium channel KCNH2 def: "A voltage-gated potassium channel Erg alpha subunit that is a translation product of the KCNH2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNH2" EXACT PRO-short-label [] synonym: "Eag homolog" EXACT [DNx] synonym: "Eag-related protein 1" EXACT [DNx] synonym: "ERG-1" EXACT [] synonym: "ether-a-go-go-related gene potassium channel 1" EXACT [] synonym: "ether-a-go-go-related protein 1" EXACT [] synonym: "H-ERG" EXACT [] synonym: "hERG-1" EXACT [] synonym: "hERG1" EXACT [] synonym: "MERG" EXACT [] synonym: "voltage-gated potassium channel subunit Kv11.1" EXACT [] synonym: "ERG" RELATED [] synonym: "ERG1" RELATED [] synonym: "HERG" RELATED [] synonym: "Merg1" RELATED [] is_a: PR:000000721 ! voltage-gated potassium channel Erg alpha subunit [Term] id: PR:000000792 name: voltage-gated potassium channel KCNH3 def: "A voltage-gated potassium channel Elk alpha subunit that is a translation product of the KHCN3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KHCN3" EXACT PRO-short-label [] synonym: "BEC1" EXACT [] synonym: "brain-specific eag-like channel 1" EXACT [] synonym: "ELK channel 2" EXACT [] synonym: "ELK2" EXACT [] synonym: "ether-a-go-go-like potassium channel 2" EXACT [] synonym: "mElk2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv12.2" EXACT [] synonym: "KCNH3" RELATED [] synonym: "KIAA1282" RELATED [] is_a: PR:000000720 ! voltage-gated potassium channel Elk alpha subunit [Term] id: PR:000000793 name: voltage-gated potassium channel KCNH4 def: "A voltage-gated potassium channel Elk alpha subunit that is a translation product of the KHCN4 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KHCN4" EXACT PRO-short-label [] synonym: "BEC2" EXACT [] synonym: "brain-specific eag-like channel 2" EXACT [] synonym: "ELK channel 1" EXACT [] synonym: "ether-a-go-go-like potassium channel 1" EXACT [] synonym: "voltage-gated potassium channel subunit Kv12.3" EXACT [] synonym: "ELK1" RELATED [] synonym: "KCNH4" RELATED [] is_a: PR:000000720 ! voltage-gated potassium channel Elk alpha subunit [Term] id: PR:000000794 name: voltage-gated potassium channel KCNH5 def: "A voltage-gated potassium channel Eag alpha subunit that is a translation product of the KHCN5 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KHCN5" EXACT PRO-short-label [] synonym: "eag2" EXACT [] synonym: "ether-a-go-go potassium channel 2" EXACT [] synonym: "hEAG2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv10.2" EXACT [] synonym: "EAG2" RELATED [] synonym: "KCNH5" RELATED [] is_a: PR:000000719 ! voltage-gated potassium channel Eag alpha subunit [Term] id: PR:000000795 name: voltage-gated potassium channel KCNH6 def: "A voltage-gated potassium channel Erg alpha subunit that is a translation product of the KHCN6 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KHCN6" EXACT PRO-short-label [] synonym: "Eag-related protein 2" EXACT [DNx] synonym: "ERG-2" EXACT [] synonym: "ether-a-go-go-related gene potassium channel 2" EXACT [] synonym: "ether-a-go-go-related protein 2" EXACT [] synonym: "hERG-2" EXACT [] synonym: "hERG2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv11.2" EXACT [] synonym: "ERG2" RELATED [] synonym: "KCNH6" RELATED [] is_a: PR:000000721 ! voltage-gated potassium channel Erg alpha subunit [Term] id: PR:000000796 name: voltage-gated potassium channel KCNH7 def: "A voltage-gated potassium channel Erg alpha subunit that is a translation product of the KHCN7 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KHCN7" EXACT PRO-short-label [] synonym: "Eag-related protein 3" EXACT [DNx] synonym: "ERG-3" EXACT [] synonym: "ether-a-go-go-related gene potassium channel 3" EXACT [] synonym: "ether-a-go-go-related protein 3" EXACT [] synonym: "hERG-3" EXACT [] synonym: "voltage-gated potassium channel subunit Kv11.3" EXACT [] synonym: "ERG3" RELATED [] synonym: "KCNH7" RELATED [] is_a: PR:000000721 ! voltage-gated potassium channel Erg alpha subunit [Term] id: PR:000000797 name: voltage-gated potassium channel KCNH8 def: "A voltage-gated potassium channel Elk alpha subunit that is a translation product of the KHCN8 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KHCN8" EXACT PRO-short-label [] synonym: "ELK channel 3" EXACT [] synonym: "ELK3" EXACT [] synonym: "ether-a-go-go-like potassium channel 3" EXACT [] synonym: "hElk1" EXACT [] synonym: "voltage-gated potassium channel subunit Kv12.1" EXACT [] synonym: "ELK1" RELATED [] synonym: "KCNH8" RELATED [] is_a: PR:000000720 ! voltage-gated potassium channel Elk alpha subunit [Term] id: PR:000000798 name: voltage-gated potassium channel KCNS1 def: "A modulatory voltage-gated potassium channel subunit KCNS that is a translation product of the KCNS1 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNS1" EXACT PRO-short-label [] synonym: "delayed-rectifier K(+) channel alpha subunit 1" EXACT [] synonym: "voltage-gated potassium channel subunit Kv9.1" EXACT [] is_a: PR:000000702 ! modulatory voltage-gated potassium channel subunit KCNS [Term] id: PR:000000799 name: voltage-gated potassium channel KCNS2 def: "A modulatory voltage-gated potassium channel subunit KCNS that is a translation product of the KCNS2 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNS2" EXACT PRO-short-label [] synonym: "delayed-rectifier K(+) channel alpha subunit 2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv9.2" EXACT [] synonym: "KIAA1144" RELATED [] is_a: PR:000000702 ! modulatory voltage-gated potassium channel subunit KCNS [Term] id: PR:000000800 name: voltage-gated potassium channel KCNS3 def: "A modulatory voltage-gated potassium channel subunit KCNS that is a translation product of the KCNS3 gene or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=gene. synonym: "KCNS3" EXACT PRO-short-label [] synonym: "delayed-rectifier K(+) channel alpha subunit 3" EXACT [] synonym: "voltage-gated potassium channel subunit Kv9.3" EXACT [] is_a: PR:000000702 ! modulatory voltage-gated potassium channel subunit KCNS [Term] id: PR:000000801 name: voltage-gated potassium channel KCNV1 isoform 1 def: "A voltage-gated potassium channel subunit KCNV1 that is a translation product of a mature transcript of the KCNV1 gene, and that includes the potassium channel alpha subunit core domains, and the atypical S6 segment. Represented by the sequence UniProtKB:Q6PIU1-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNV1/iso:1" EXACT PRO-short-label [] is_a: PR:000000725 ! voltage-gated potassium channel KCNV1 [Term] id: PR:000000802 name: voltage-gated potassium channel KCNV2 isoform 1 def: "A voltage-gated potassium channel KCNV2 that is a translation product of a mature transcript of the KCNV2 gene, and that contains the core domains. Represented by the sequence UniProtKB:Q8TDN2-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNV2/iso:1" EXACT PRO-short-label [] is_a: PR:000000726 ! voltage-gated potassium channel KCNV2 [Term] id: PR:000000803 name: voltage-gated potassium channel KCNV2 sequence variant 1 def: "A voltage-gated potassium channel KCNV2 that has an Asp residue at the position equivalent to Gly-459 in the human sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S5 and S6." [PMID:16909397] comment: Category=sequence. is_a: PR:000000726 ! voltage-gated potassium channel KCNV2 [Term] id: PR:000000804 name: voltage-gated potassium channel KCNV2 sequence variant 2 def: "A voltage-gated potassium channel KCNV2 that has a Val residue at the position equivalent to Ala-259 in the human sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S1 and S2." [PMID:16909397] comment: Category=sequence. is_a: PR:000000726 ! voltage-gated potassium channel KCNV2 [Term] id: PR:000000805 name: voltage-gated potassium channel KCNV2 sequence variant 3 def: "A voltage-gated potassium channel KCNV2 that has a Gln residue at the position equivalent to Leu-126 in the human sequence UniProtKB:Q8TDN2-1. This residue is located in the cytoplasmic N-terminus." [PMID:16909397] comment: Category=sequence. is_a: PR:000000726 ! voltage-gated potassium channel KCNV2 [Term] id: PR:000000806 name: voltage-gated potassium channel KCNV2 sequence variant 4 def: "A voltage-gated potassium channel KCNV2 that is a translation product of a sequence variant of the KCNV2 gene that has a deletion of the region corresponding to residues 339 to 341 in the human sequence UniProtKB:Q8TDN2-1. These residues are part of segment S3." [PMID:16909397] comment: Category=sequence. is_a: PR:000000726 ! voltage-gated potassium channel KCNV2 [Term] id: PR:000000807 name: voltage-gated potassium channel KCNV2 sequence variant 5 def: "A voltage-gated potassium channel KCNV2 that has a Trp residue at the position equivalent to Ser-256 in sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S1 and S2." [PMID:16909397] comment: Category=sequence. is_a: PR:000000726 ! voltage-gated potassium channel KCNV2 [Term] id: PR:000000808 name: voltage-gated potassium channel KCNV2 sequence variant 6 def: "A voltage-gated potassium channel KCNV2 that has a Cys residue at the position equivalent to Trp-188 in sequence UniProtKB:Q8TDN2-1. This residue is located in the loop connecting segments S1 and S2." [PMID:16909397] comment: Category=sequence. is_a: PR:000000726 ! voltage-gated potassium channel KCNV2 [Term] id: PR:000000809 name: voltage-gated potassium channel subunit KCNA10 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA10 gene or a 1:1 ortholog thereof. It is a subunit of the Kv1.8 channel is a delayed rectifier channel that may be involved in regulating the tone of renal vascular smooth muscle and may also participate in the cardiac action potential. It is regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. It can coassemble with other Kv1 subunits." [PMID:10836990] comment: Category=gene. synonym: "KCNA10" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv1.8" EXACT [] is_a: PR:000000709 ! shaker-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000810 name: voltage-gated potassium channel subunit KCNA2 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA2 gene or a 1:1 ortholog thereof. The Kv1.2 channel is involved in maintaining membrane potential, modulating electrical excitability in neurons and muscle. It can coassemble with other Kv1 subunits." [PMID:16382104] comment: Category=gene. synonym: "KCNA2" EXACT PRO-short-label [] synonym: "NGK1" EXACT [] synonym: "voltage-gated K(+) channel HuKIV" EXACT [] synonym: "voltage-gated potassium channel HBK5" EXACT [] synonym: "voltage-gated potassium channel subunit Kv1.2" EXACT [] synonym: "MK2" RELATED [] is_a: PR:000000709 ! shaker-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000811 name: voltage-gated potassium channel subunit KCNA3 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA3 gene or a 1:1 ortholog thereof. The Kv1.3 channel is involved in maintaining membrane potential and calcium signaling in lymphocytes and oligodendrocytes. It can coassemble with other Kv1 subunits." [PRO:CNA] comment: Category=gene. synonym: "KCNA3" EXACT PRO-short-label [] synonym: "HGK5" EXACT [] synonym: "HLK3" EXACT [] synonym: "HPCN3" EXACT [] synonym: "MK3" EXACT [] synonym: "voltage-gated K(+) channel HuKIII" EXACT [] synonym: "voltage-gated potassium channel subunit Kv1.3" EXACT [] is_a: PR:000000709 ! shaker-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000812 name: voltage-gated potassium channel subunit KCNA5 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA5 gene or a 1:1 ortholog thereof. The voltage-gated potassium channel Kv1.5 mediates the ultrarapid-activating potassium current (IKur) in heart, and also plays a critical role in the regulation of arterial tone." [PMID:10575199, PMID:16772329, PMID:18344374] comment: Category=gene. synonym: "KCNA5" EXACT PRO-short-label [] synonym: "HPCN1" EXACT [] synonym: "KV1-5" EXACT [] synonym: "voltage-gated potassium channel HK2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv1.5" EXACT [] xref: PANTHER:PTHR11537\:SF25 is_a: PR:000000709 ! shaker-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000813 name: voltage-gated potassium channel subunit KCNA6 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA6 gene or a 1:1 ortholog thereof. The Kv1.6 channel is Regulator of membrane potential in neurons. The N terminus contains an N terminus inactivation prevention domain. It can coassemble with other Kv1 subunits." [PRO:CNA] comment: Category=gene. synonym: "KCNA6" EXACT PRO-short-label [] synonym: "MK1.6" EXACT [] synonym: "voltage-gated potassium channel HBK2" EXACT [] synonym: "voltage-gated potassium channel subunit Kv1.6" EXACT [] is_a: PR:000000709 ! shaker-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000814 name: voltage-gated potassium channel subunit KCNA7 def: "A voltage-gated potassium channel alpha subunit that is a translation product of the KCNA7 gene or a 1:1 ortholog thereof. The Kv1.7 channel has properties similar to the ultrarapidly activating IKur current in the heart. It can coassemble with other Kv1 subunits." [PRO:CNA] comment: Category=gene. synonym: "KCNA7" EXACT PRO-short-label [] synonym: "voltage-gated potassium channel subunit Kv1.7" EXACT [] synonym: "Kcnc7" RELATED [] is_a: PR:000000709 ! shaker-related voltage-gated potassium channel alpha subunit [Term] id: PR:000000815 name: voltage-gated potassium channel subunit KCNQ1 isoform 1 def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a mature transcript of the KCNQ1 gene, that includes the core domains. Represented by the sequence UniProtKB:P51787-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ1/iso:1" EXACT PRO-short-label [] is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000816 name: voltage-gated potassium channel subunit KCNQ1 isoform 2 def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a mature transcript of the KCNQ1 gene, that lacks the N-terminal cytoplasmic domain and the initial one-third of the first transmembrane domain. Represented by the sequence UniProtKB:P51787-2. This form is not able to generate channels by itself, but can form a channel when associated with KCNE4 or the isoform 1 (PR:000000815)." [PMID:9305853] comment: Category=sequence. synonym: "KCNQ1/iso:2" EXACT PRO-short-label [] synonym: "atKvLQT1" EXACT [] is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000817 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 1 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Met residue at the position equivalent to Thr-587 in the human sequence UniProtKB:P51787-1." [PMID:10024302] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000818 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 10 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Pro residue at the position equivalent to Ser-373 in the human sequence UniProtKB:P51787-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000819 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 11 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Arg-243 in the human sequence UniProtKB:P51787-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000820 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 12 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Asn residue at the position equivalent to Asp-317 in the human sequence UniProtKB:P51787-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000821 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 13 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Ile residue at the position equivalent to Val-310 in the human sequence UniProtKB:P51787-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000822 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 14 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Phe residue at the position equivalent to Ser-566 in the human sequence UniProtKB:P51787-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000823 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 15 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Tyr-315 in the human sequence UniProtKB:P51787-1." [PMID:9927399] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000824 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 16 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Leu residue at the position equivalent to Ser-225 in the human sequence UniProtKB:P51787-1." [PMID:9927399] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000825 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 17 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Pro residue at the position equivalent to Ala-178 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:9323054] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000826 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 18 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Thr residue at the position equivalent to Ala-178 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:9024139] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000827 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 19 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Gly-189 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic loop connecting S2-S3." [PMID:10220144] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000828 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 2 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Pro-448 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [UniProtKB_VAR:VAR_009931] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000829 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 20 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Thr-309 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [UniProtKB_VAR:VAR_001529.] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000830 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 21 def: "A voltage-gated potassium channel subunit KCNQ1 that has a His residue at the position equivalent to Arg-591 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10024302] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000831 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 22 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Trp residue at the position equivalent to Arg-366 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:9693036] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000832 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 23 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Met residue at the position equivalent to Ile-313 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9024139] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000833 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 24 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Tyr-111 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic N-terminus." [UniProtKB_VAR:VAR_009918] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000834 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 25 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Trp residue at the position equivalent to Arg-533 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10728423] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000835 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 26 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Gly-168 in the human sequence UniProtKB:P51787-1. This residue is located at the end of segment S2." [PMID:9693036] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000836 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 27 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Asp residue at the position equivalent to Glu-261 in the human sequence UniProtKB:P51787-1. This residue is located at the end of the intracellular loop connecting segments S4 and S5." [UniProtKB_VAR:VAR_008944] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000837 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 28 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Thr residue at the position equivalent to Ala-371 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [UniProtKB_VAR:VAR_001544] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000838 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 29 def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a sequence variant of the KCNQ1 gene that includes the deletion of the region coding for residues 71 to 73 in the human sequence UniProtKB:P51787-1." [UniProtKB_VAR:VAR_009917] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000839 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 3 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Val residue at the position equivalent to Ala-341 in the human sequence UniProtKB:P51787-1. This residue is located within the S6 segment." [PMID:8872472] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000840 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 30 def: "A voltage-gated potassium channel subunit KCNQ1 that has a His residue at the position equivalent to Leu-250 in the human sequence UniProtKB:P51787-1." [UniProtKB_VAR:VAR_008943] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000841 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 31 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Trp residue at the position equivalent toSer-349 in the human sequence UniProtKB:P51787-1." [UniProtKB_VAR:VAR_009928] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000842 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 32 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Ile residue at the position equivalent to Thr-391 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000843 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 33 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Asn residue at the position equivalent to Lys-318 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9693036] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000844 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 34 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Val residue at the position equivalent to Ala-344 in the human sequence UniProtKB:P51787-1." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000845 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 35 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Thr residue at the position equivalent to Ala-525 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10482963] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000846 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 36 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Glu residue at the position equivalent to Ala-341 in the human sequence UniProtKB:P51787-1." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000847 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 37 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Arg-583 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000848 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 38 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Asn residue at the position equivalent to Asp-242 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S2." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000849 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 39 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Phe residue at the position equivalent to Leu-342 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S6." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000850 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 4 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Gly-306 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000851 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 40 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Gly residue at the position equivalent to Ser-140 in the human sequence UniProtKB:P51787-1. This residue is located in the segment S1." [PMID:12522251] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000852 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 41 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Ser residue at the position equivalent to Gly-269 in the human sequence UniProtKB:P51787-1. This residue is located within segment S5." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000853 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 42 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Arg-555 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PRO:CNA] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000854 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 43 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Trp residue at the position equivalent to Arg-539 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus. This amino acid change affects the interaction with other channel subunits." [PMID:10728423] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000855 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 44 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Ser residue at the position equivalent to Tyr-315 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10220144] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000856 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 45 def: "A voltage-gated potassium channel subunit KCNQ1 that has a His residue at the position equivalent to Arg-174 in the human sequence UniProtKB:P51787-1. This residue is located in the loop between segments S2 and S3." [PMID:10367071] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000857 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 46 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Pro residue at the position equivalent to Ala-194 in the human sequence UniProtKB:P51787-1. This residue is located in the loop between segments S2 and S3." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000858 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 47 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Ser residue at the position equivalent to Tyr-184 in the human sequence UniProtKB:P51787-1. This residue is located in the loop between segments S2 and S3." [PMID:10220144] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000859 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 48 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Glu residue at the position equivalent to Gly-345 in the human sequence UniProtKB:P51787-1. This residue is located within segment S6." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000860 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 49 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Gln residue at the position equivalent to Arg-190 in the human sequence UniProtKB:P51787-1." [PMID:10728423] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000861 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 5 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Ile residue at the position equivalent to Thr-311 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9482580] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000862 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 50 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Ser residue at the position equivalent to Gly-314 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9693036] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000863 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 51 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Trp-248 in the human sequence UniProtKB:P51787-1. This residue is located within segment S4. This amino acid change affects the interaction with other channel subunits." [PMID:10409658] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000864 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 52 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Pro residue at the position equivalent to Arg-366 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:9024139] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000865 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 53 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Gln residue at the position equivalent to Arg-366 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000866 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 54 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Lys residue at the position equivalent to Glu-160 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S2." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000867 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 55 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Met residue at the position equivalent to Val-254 in the human sequence UniProtKB:P51787-1." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000868 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 56 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Gly-345 in the human sequence UniProtKB:P51787-1. This residue is located within segment S6." [PMID:10220144] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000869 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 57 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Lys residue at the position equivalent to Glu-261 in the human sequence UniProtKB:P51787-1. This residue is located at the end of the intracellular loop connecting segments S4 and S5." [PMID:10409658] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000870 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 58 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Leu residue at the position equivalent to Val-307 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:15159330] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000871 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 59 def: "A voltage-gated potassium channel subunit KCNQ1 that is a translation product of a sequence variant of the KCNQ1 gene that lacks a Phe residue at the position equivalent to Phe-339 in the human sequence UniProtKB:P51787-1. This residue is located within segment S6." [PMID:9702906] comment: Category=sequence. synonym: "deltaF339" RELATED [] is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000872 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 6 def: "A voltage-gated potassium channel subunit KCNQ1 that has a His residue at the position equivalent to Arg-243 in the human sequence UniProtKB:P51787-1. This residue is located in segment S4." [PMID:10728423] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000873 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 60 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Ser residue at the position equivalent to Gly-179 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:10728423] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000874 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 61 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Thr residue at the position equivalent to Ala-300 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9641694] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000875 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 62 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Arg-174 in the human sequence UniProtKB:P51787-1. This residue is located in the loop connecting segments S2 and S3." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000876 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 63 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Ser residue at the position equivalent to Trp-305 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9781056] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000877 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 64 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Pro residue at the position equivalent to Leu-266 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S5." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000878 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 65 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Gln residue at the position equivalent to Arg-594 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000879 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 66 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Phe residue at the position equivalent to Leu-273 in the human sequence UniProtKB:P51787-1. This residue is located within the segment S5." [PMID:9323054] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000880 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 67 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Tyr-281 in the human sequence UniProtKB:P51787-1. This residue is located within segment S5." [PMID:9927399] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000881 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 68 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Ala residue at the position equivalent to Pro-320 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000882 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 69 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Cys residue at the position equivalent to Phe-157 in the human sequence UniProtKB:P51787-1. This residue is located within segment S2." [PMID:10220146] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000883 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 7 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Pro residue at the position equivalent to Leu-353 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:9693036] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000884 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 70 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Gly-325 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:9024139] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000885 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 71 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Trp-392 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10220144] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000886 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 72 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Asp residue at the position equivalent to Gly-269 in the human sequence UniProtKB:P51787-1. This residue is located within segment S5." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000887 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 73 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Asp residue at the position equivalent to Gly-589 in the human sequence UniProtKB:P51787-1." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000888 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 74 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Arg residue at the position equivalent to Gly-216 in the human sequence UniProtKB:P51787-1. This residue is located within segment S2." [PMID:9272155] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000889 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 8 def: "A voltage-gated potassium channel subunit KCNQ1 that has a Met residue at the position equivalent to Val-417 in the human sequence UniProtKB:P51787-1. This residue is located in the cytoplasmic C-terminus." [PMID:10704188] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000890 name: voltage-gated potassium channel subunit KCNQ1 sequence variant 9 def: "A voltage-gated potassium channel subunit KCNQ1 that has an Ile residue at the position equivalent to Thr-312 in the human sequence UniProtKB:P51787-1. This mutation is located in the pore region between segments S5 and S6." [PMID:10409658] comment: Category=sequence. is_a: PR:000000728 ! voltage-gated potassium channel subunit KCNQ1 [Term] id: PR:000000891 name: voltage-gated potassium channel subunit KCNQ2 isoform 1 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 8-11, exons12 and 13 both with 5 prime alternative spliced site, and the absence of the region coded by exon 15a. It includes the in-frame exon 16. Represented by the sequence UniProtKB:Q9Z351-12. Exon nomenclature is based on PMID:11230508." [PMID:11230508] comment: Category=sequence. synonym: "KCNQ2/iso:1" EXACT PRO-short-label [] synonym: "K2KL" EXACT [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000892 name: voltage-gated potassium channel subunit KCNQ2 isoform 10 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. This renders a protein lacking the region coded by exons 7- 16. Represented by the sequence UniProtKB:Q9Z351-10 with unique C-terminus sequence VSLSPC." [PMID:9666519] comment: Category=sequence. synonym: "KCNQ2/iso:10" EXACT PRO-short-label [] synonym: "MKQT2.10" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000893 name: voltage-gated potassium channel subunit KCNQ2 isoform 11 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains the transmembrane segments (S1-S5), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. This renders a protein with a different sequence at the end of segment S6, and lacking the C-terminus region coded by exons 7-16. Represented by the sequence UniProtKB:Q9Z351-11." [PMID:9666519] comment: Category=sequence. synonym: "KCNQ2/iso:11" EXACT PRO-short-label [] synonym: "MKQT2.11" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000894 name: voltage-gated potassium channel subunit KCNQ2 isoform 12 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6). It is characterized by the absence of exon 8,and 11, the presence of the region coded by the five prime alternative spliced exons 12-13, but has a shorter and alternative C-terminus compare to isoform 1 after exon 14. This renders a protein lacking the region coded by exons 15-16. Represented by the sequence UniProtKB:Q9Z351-2, with C-terminal sequence QEPLPVQSGHEQGPPGQNQAWHKGHQGLGD." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:12" EXACT PRO-short-label [] synonym: "MKQT2.2" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000895 name: voltage-gated potassium channel subunit KCNQ2 isoform 13 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by lacking of the region encoded by exons 8, 11, an alternative exon 15, and has an alternative C-terminus compared to isoform 1. Represented by the sequence UniProtKB:Q9Z351-3. Exon nomenclature is based on PMID:11230508." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:13" EXACT PRO-short-label [] synonym: "MKQT2.3" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000896 name: voltage-gated potassium channel subunit KCNQ2 isoform 14 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by lacking of the region encoded by exons 8, 11, 15a, and has an alternative C-terminus compared to isoform 1. Represented by the sequence UniProtKB:Q9Z351-4. Exon nomenclature is based on PMID:11230508." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:14" EXACT PRO-short-label [] synonym: "MKQT2.4" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000897 name: voltage-gated potassium channel subunit KCNQ2 isoform 15 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6). It is characterized by the absence of exon 8,and 11, the presence of the region coded by the five prime alternative spliced exons 12-13, but has a shorter and alternative C-terminus compare to isoform 1 after exon 14. This renders a protein lacking the region coded by exons 15-16. Represented by the sequence UniProtKB:Q9Z351-5, with C-terminal sequence RSCDWRGVLA." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:15" EXACT PRO-short-label [] synonym: "MKQT2.5" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000898 name: voltage-gated potassium channel subunit KCNQ2 isoform 16 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6). It is characterized by the absence of exon 8,and 11, the presence of the region coded by the five prime alternative spliced exons 12-13, but has a shorter and alternative C-terminus compare to isoform 1 after exon 14. This renders a protein lacking the region coded by exons 15-16. Represented by the sequence UniProtKB:Q9Z351-6, with C-terminal sequence QEPLPVQSGHEQGPPGQNQAWHKGHQGLGDRCAEQGQYQLWRSLPTLLASCCFLLCFHTVCF." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:16" EXACT PRO-short-label [] synonym: "MKQT2.6" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000899 name: voltage-gated potassium channel subunit KCNQ2 isoform 2 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 8-10, exons12 and 13 both with 5 prime alternative spliced site, and the absence of the region coded by exons 11 and 15a. It includes the in-frame exon 16. Represented by the sequence UniProtKB:O43526-2. Exon nomenclature is based on PMID:11230508." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:2" EXACT PRO-short-label [] synonym: "KCNQ2L" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000900 name: voltage-gated potassium channel subunit KCNQ2 isoform 3 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 9-10, exons12 and 13 both with 5 prime alternative spliced site, and the absence of the region coded by exons 8, 11 and 15a. It includes the in-frame exon 16. Represented by the sequence UniProtKB:O43526-3. Exon nomenclature is based on PMID:11230508." [PMID:9430594] comment: Category=sequence. synonym: "KCNQ2/iso:3" EXACT PRO-short-label [] synonym: "isoform C" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000901 name: voltage-gated potassium channel subunit KCNQ2 isoform 4 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exons 8, 12 and 13 (both with the 3 prime splice site) and the absence of the region coded by exons 11 and 15a. It includes the in-frame exon 16. Represented by the sequence UniProtKB:O43526-4. Exon nomenclature is based on PMID:11230508." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:4" EXACT PRO-short-label [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000902 name: voltage-gated potassium channel subunit KCNQ2 isoform 5 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by lacking a short exon encoding 10 amino acids roughly 50 residues COOH-terminal from S6. It contains the region encoded by exons 8, 11, 12-13 both with 5 prime alternative spliced site, and the absence of the region coded by exon 15a. It includes the in-frame exon 16. Represented by the sequence UniProtKB:O43526-5. Exon nomenclature is based on PMID:11230508." [PMID:11230508] comment: Category=sequence. synonym: "KCNQ2/iso:5" EXACT PRO-short-label [] synonym: "K2deltaKdeltaL" EXACT [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000903 name: voltage-gated potassium channel subunit KCNQ2 isoform 6 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. UniProtKB:O43526-6. Inclusion of isoform 6 in heteromultimers results in attenuation of potassium current. Prominent expression of isoform 6 in the developing brain may alter firing repertoires of immature neurons excitability to provide cues for proliferation rather than differentiation." [PMID:9039501] comment: Category=sequence. synonym: "KCNQ2/iso:6" EXACT PRO-short-label [] synonym: "HNSPC" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000904 name: voltage-gated potassium channel subunit KCNQ2 isoform 7 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by presence of the region encoded by exon 8, and a different and shorter C-terminal sequence after exon 10 due to the usage of an alternative splice site causing a frameshift. This C-terminal region is common to isoform 8 (PR:000000905). Represented by the sequence UniProtKB:Q9Z351-7." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:7" EXACT PRO-short-label [] synonym: "MKQT2.7" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000905 name: voltage-gated potassium channel subunit KCNQ2 isoform 8 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene. It contains all the transmembrane segments and it is characterized by the absence of the region encoded by exon 8, and a different and shorter C-terminal sequence after exon 10 due to the usage of an alternative splice site causing a frameshift. This C-terminal region is common to isoform 7 (PR:000000904). Represented by the sequence UniProtKB:Q9Z351-8." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ2/iso:8" EXACT PRO-short-label [] synonym: "MKQT2.8" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000906 name: voltage-gated potassium channel subunit KCNQ2 isoform 9 def: "A voltage-gated potassium channel subunit KCNQ2 that is a translation product of a mature transcript of the KCNQ2 gene, and contains all the transmembrane segments (S1-S6), but has a shorter and alternative C-terminus compare to isoform 1 due to the use of an alternative splice site that creates a frameshift. This renders a protein lacking the region coded by exons 7- 16. Represented by the sequence UniProtKB:Q9Z351-9 with unique C-terminus sequence GQVRCAGH." [PMID:9666519] comment: Category=sequence. synonym: "KCNQ2/iso:9" EXACT PRO-short-label [] synonym: "MKQT2.9" RELATED [] is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000907 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 1 def: "A voltage-gated potassium channel subunit KCNQ2 that has a Trp residue at the position equivalent to Ser-247 in sequence UniProtKB:O43526-1. This mutation is located within the transmembrane S5. This form reduces the current amplitude of KCNQ2 homomeric channels in a dominant-negative manner whereas the amplitude of KCNQ2/KCNQ3 heteromers is only reduced by about 40%." [PMID:12742592] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000908 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 10 def: "A voltage-gated potassium channel subunit KCNQ2 that has a Gln residue at the position equivalent to His-228 in sequence UniProtKB:O43526-1. This mutation is located in the intracellular loop between S4-S5." [PRO:CNA] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000909 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 2 def: "A Potassium voltage-gated channel subfamily KQT member 2 that has a Trp residue at the position equivalent to Arg-207 in the human sequence UniProtKB:O43526-1. This mutation neutralizes a charged amino acid in the S4 voltage-sensor segment of KCNQ2. This substitution leads to a shift of voltage-dependent activation of KCNQ2 and a dramatic slowing of activation upon depolarization." [PMID:11572947] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000910 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 3 def: "A voltage-gated potassium channel subunit KCNQ2 that has a Phe residue at the position equivalent to Leu-243 in sequence UniProtKB:O43526-1." [PMID:14534157] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000911 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 4 def: "A voltage-gated potassium channel subunit KCNQ2 that has a change of one of the innermost Arg residues of the key functional voltage sensor (S4) region. Example: Trp residue at the position equivalent to Arg-214 in the human sequence UniProtKB:O43526-1." [PMID:11175290] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000912 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 5 def: "A voltage-gated potassium channel subunit KCNQ2 that has a Cys residue at the position equivalent to Tyr-284 in the human sequence UniProtKB:O43526-1. This mutation is located in the pore region and produces a reduction of wild type heteromeric currents." [PMID:9425895] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000913 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 6 def: "A voltage-gated potassium channel subunit KCNQ2 that has a Thr residue at the position equivalent to Ala-306 in sequence UniProtKB:O43526-1. This mutation is located in transmembrane domain S6 and causes a reduction of wild type heteromeric currents." [PMID:10788442] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000914 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 7 def: "A voltage-gated potassium channel subunit KCNQ2 that has a Gln residue at the position equivalent to Arg-333 in sequence UniProtKB:O43526-1. This mutation is located in the C-terminal segment." [PMID:14534157] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000915 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 8 def: "A voltage-gated potassium channel subunit KCNQ2 that has a Val residue at the position equivalent to Met-208 in sequence UniProtKB:O43526-1. This mutation is located in the S4 transmembrane domain and causes minor effect on maximal current but clearly exhibits a faster rate of deactivation." [PMID:14534157] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000916 name: voltage-gated potassium channel subunit KCNQ2 sequence variant 9 def: "A voltage-gated potassium channel subunit KCNQ2 that has an Asn residue at the position equivalent to Lys-526 in sequence UniProtKB:O43526-3. This mutation lies within the minimum KCNQ2 sequence necessary for CaM binding." [PMID:15249611] comment: Category=sequence. is_a: PR:000000729 ! voltage-gated potassium channel subunit KCNQ2 [Term] id: PR:000000917 name: voltage-gated potassium channel subunit KCNQ3 isoform 1 def: "A voltage-gated potassium channel subunit KCNQ3 that is a translation product of a mature transcript of the KCNQ3 gene, and that contains the core domains. Represented by the sequence UniProtKB:O43525-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ3/iso:1" EXACT PRO-short-label [] is_a: PR:000000730 ! voltage-gated potassium channel subunit KCNQ3 [Term] id: PR:000000918 name: voltage-gated potassium channel subunit KCNQ4 isoform 1 def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of a mature transcript of the KCNQ4 gene, and that includes all core domains. Represented by the sequence UniProtKB:P56696-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ4/iso:1" EXACT PRO-short-label [] is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000919 name: voltage-gated potassium channel subunit KCNQ4 isoform 2 def: "A voltage-gated potassium channel subunit KCNQ4 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:P56696-2 or a 1:1 ortholog thereof." [PMID:10025409] comment: Category=sequence. synonym: "KCNQ4/iso:2" EXACT PRO-short-label [] is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000920 name: voltage-gated potassium channel subunit KCNQ4 sequence variant 1 def: "A voltage-gated potassium channel subunit KCNQ4 that has a Cys residue replacing the first Gly in the conserved selectivity filter sequence GYGD in the pore region of the human sequence UniProtKB:P56696-1." [PRO:CNA] comment: Category=sequence. is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000921 name: voltage-gated potassium channel subunit KCNQ4 sequence variant 2 def: "A voltage-gated potassium channel subunit KCNQ4 that has a His residue at the position equivalent to Leu-274 in the human sequence UniProtKB:P56696-1. This residue is located in the pore region located between segments S5 and S6." [PMID:10925378] comment: Category=sequence. is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000922 name: voltage-gated potassium channel subunit KCNQ4 sequence variant 3 def: "A voltage-gated potassium channel subunit KCNQ4 that has a Cys residue replacing the first Gly in the conserved selectivity filter sequence GYGD in the pore region of the human sequence UniProtKB:P56696-1." [PMID:10025409] comment: Category=sequence. is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000923 name: voltage-gated potassium channel subunit KCNQ4 sequence variant 4 def: "A voltage-gated potassium channel subunit KCNQ4 that has a Ser residue at the position equivalent to Leu-281 in sequence UniProtKB:P56696-1. This residue is located in the pore region located between segments S5 and S6." [PRO:CNA] comment: Category=sequence. is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000924 name: voltage-gated potassium channel subunit KCNQ4 sequence variant 5 def: "A voltage-gated potassium channel subunit KCNQ4 that has a Ser residue at the position equivalent to Trp-276 in sequence UniProtKB:P56696-1. This residue is located in the pore region located between segments S5 and S6." [PMID:10369879] comment: Category=sequence. is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000925 name: voltage-gated potassium channel subunit KCNQ4 sequence variant 6 def: "A voltage-gated potassium channel subunit KCNQ4 that has a Ser residue at the position equivalent to Gly-321 in sequence UniProtKB:P56696-1." [PMID:10369879] comment: Category=sequence. is_a: PR:000000731 ! voltage-gated potassium channel subunit KCNQ4 [Term] id: PR:000000926 name: voltage-gated potassium channel subunit KCNQ5 isoform 1 def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q9NR82-1 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ5/iso:1" EXACT PRO-short-label [] is_a: PR:000000732 ! voltage-gated potassium channel subunit KCNQ5 [Term] id: PR:000000927 name: voltage-gated potassium channel subunit KCNQ5 isoform 2 def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q9NR82-2 or a 1:1 ortholog thereof." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ5/iso:2" EXACT PRO-short-label [] is_a: PR:000000732 ! voltage-gated potassium channel subunit KCNQ5 [Term] id: PR:000000928 name: voltage-gated potassium channel subunit KCNQ5 isoform 3 def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of some mRNA giving rise to a protein with the amino acid sequence represented by UniProtKB:Q9NR82-3. This isoform displays altered gating kinetics or a 1:1 ortholog thereof." [PMID:10816588, PRO:CNA] comment: Category=sequence. synonym: "KCNQ5/iso:3" EXACT PRO-short-label [] is_a: PR:000000732 ! voltage-gated potassium channel subunit KCNQ5 [Term] id: PR:000000929 name: voltage-gated potassium channel subunit KCNQ5 isoform 4 def: "A voltage-gated potassium channel subunit KCNQ5 that is a translation product of the mature transcript of KCNQ5 gene, and lacks the C-terminal KCNQ voltage-gated potassium channel domain. Represented by the sequence UniProtKB:Q9NR82-4." [PRO:CNA] comment: Category=sequence. synonym: "KCNQ5/iso:4" EXACT PRO-short-label [] is_a: PR:000000732 ! voltage-gated potassium channel subunit KCNQ5 [Term] id: PR:000000932 name: cGMP-gated cation channel alpha-1 isoform 1 phosphorylated form def: "A cGMP-gated cation channel alpha-1 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000737 ! cGMP-gated cation channel alpha-1 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000933 name: platelet-derived growth factor C isoform 1 cleaved form def: "A platelet-derived growth factor C isoform 1 that has been processed by proteolytic cleavage." [PRO:CNA] comment: Please consider a PR:000018298 that derives_from PR:000000754. is_obsolete: true consider: PR:000018298 [Term] id: PR:000000934 name: platelet-derived growth factor C isoform 1 sumoylated form def: "A platelet-derived growth factor C isoform 1 that has been post-translationally modified to include at least one sumoylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000754 ! platelet-derived growth factor C isoform 1 intersection_of: has_part MOD:01149 ! sumoylated lysine [Term] id: PR:000000935 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated form def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000755 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000936 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated form def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000756 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000937 name: transient receptor potential cation channel TRPC3 isoform 1 def: "A transient receptor potential cation channel TRPC3 that is a translation product of a mature transcript of the TRPC3 gene, and that includes the core domains. Represented by the sequence UniProtKB:Q13507-1." [PRO:HJD] comment: Category=sequence. synonym: "TRPC3/iso:1" EXACT PRO-short-label [] is_a: PR:000000775 ! transient receptor potential cation channel TRPC3 [Term] id: PR:000000938 name: voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated 1 def: "A voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated for with has been phosphorylated at the Ser residue located at the N-terminal Glu rich sequence ELSEEEEDEEEEEEEEEEGR. Example:UniProtKB:Q8CBF8-1, has_part MOD:00046 O-phospho-L-serine, Ser-122." [PMID:18056256] comment: Category=modification. is_a: PR:000000778 ! voltage-gated potassium channel alpha subunit KCNA4 isoform 1 phosphorylated form [Term] id: PR:000000939 name: voltage-gated potassium channel KCNC1 isoform 1 def: "A voltage-gated potassium channel KCNC1 that is a translation product of a mature transcript of the KCNC1 gene, and that includes the core domains and a short C-terminal tail. Represented by the sequence UniProtKB:P48547-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNC1/iso:1" EXACT PRO-short-label [] synonym: "Kv3.1a" RELATED [] is_a: PR:000000781 ! voltage-gated potassium channel KCNC1 [Term] id: PR:000000940 name: voltage-gated potassium channel KCNC1 isoform 2 def: "A voltage-gated potassium channel KCNC1 that is a translation product of a mature transcript of the KCNC1 gene, and that includes the core domains and the longest C-terminal tail compare to isoform 1. Represented by the sequence UniProtKB:P25122-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNC1/iso:2" EXACT PRO-short-label [] synonym: "Kv3.1b" EXACT [] is_a: PR:000000781 ! voltage-gated potassium channel KCNC1 [Term] id: PR:000000941 name: voltage-gated potassium channel KCNC2 isoform 1 def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains. Represented by the sequence UniProtKB:P22462-1." [PMID:1879548] comment: Category=sequence. synonym: "KCNC2/iso:1" EXACT PRO-short-label [] synonym: "KV3.2B" EXACT [] is_a: PR:000000782 ! voltage-gated potassium channel KCNC2 [Term] id: PR:000000942 name: voltage-gated potassium channel KCNC2 isoform 2 def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains, but includes an alternative 3' exon coding region at the C-terminus compared to isoform 1. Represented by the sequence UniProtKB:Q96PR1-2." [PRO:CNA] comment: Category=sequence. synonym: "KCNC2/iso:2" EXACT PRO-short-label [] synonym: "Kv3.2d" RELATED [] is_a: PR:000000782 ! voltage-gated potassium channel KCNC2 [Term] id: PR:000000943 name: voltage-gated potassium channel KCNC2 isoform 3 def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains, but includes an alternative 3' exon coding region at the C-terminus compared to isoform 1. Represented by the sequence UniProtKB:Q96PR1-3." [PRO:CNA] comment: Category=sequence. synonym: "KCNC2/iso:3" EXACT PRO-short-label [] synonym: "KV3.2a" EXACT [] synonym: "RKShIIIA" RELATED [] is_a: PR:000000782 ! voltage-gated potassium channel KCNC2 [Term] id: PR:000000944 name: voltage-gated potassium channel KCNC2 isoform 4 def: "A voltage-gated potassium channel KCNC2 that is a translation product of a mature transcript of the KCNC2 gene, and that includes the core domains, but includes an alternative 3' exon coding region at the C-terminus compared to isoform 1. This form lacks a region of around 80 residues at the C-terminus. Represented by the sequence UniProtKB:Q96PR1-4." [PRO:CNA] comment: Category=sequence. synonym: "KCNC2/iso:4" EXACT PRO-short-label [] synonym: "Kv3.2c" EXACT [] is_a: PR:000000782 ! voltage-gated potassium channel KCNC2 [Term] id: PR:000000945 name: voltage-gated potassium channel KCNC4 isoform 1 def: "A voltage-gated potassium channel KCNC4 that is a translation product of a mature transcript of the KCNC4 gene, and that contains the core domains. Represented by the sequence UniProtKB:Q03721-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNC4/iso:1" EXACT PRO-short-label [] is_a: PR:000000783 ! voltage-gated potassium channel KCNC4 [Term] id: PR:000000946 name: voltage-gated potassium channel KCNC4 isoform 2 def: "A voltage-gated potassium channel KCNC4 that is a translation product of a mature transcript of the KCNC4 gene, and that includes the core domains but has a shorter C-terminal cytoplasmic tail as compared to isoform 1. Represented by the sequence UniProtKB:Q03721-2." [PMID:1381835] comment: Category=sequence. synonym: "KCNC4/iso:2" EXACT PRO-short-label [] is_a: PR:000000783 ! voltage-gated potassium channel KCNC4 [Term] id: PR:000000947 name: voltage-gated potassium channel KCND2 isoform 1 def: "A voltage-gated potassium channel subunit KCND2 that is a translation product of a mature transcript of the KCND2 gene, and that includes the potassium channel alpha subunit core domains. Represented by the sequence UniProtKB:Q9NZV8-1." [PRO:CNA] comment: Category=sequence. synonym: "KCND2/iso:1" EXACT PRO-short-label [] synonym: "Kv4.2" EXACT [] is_a: PR:000000785 ! voltage-gated potassium channel KCND2 [Term] id: PR:000000948 name: voltage-gated potassium channel KCND3 isoform 1 def: "A voltage-gated potassium channel subunit KCND3 that is a translation product of a mature transcript of the KCND3 gene, with carboxyl-terminal splicing that inserts 19 amino acids with a consensus protein kinase C (PKC) phosphorylation site after the last membrane-spanning segment. This form is downregulated by PKC activation. Represented by the sequence UniProtKB:Q9UK17-1." [PMID:9843794] comment: Category=sequence. synonym: "KCND3/iso:1" EXACT PRO-short-label [] synonym: "KCND3L" RELATED [] synonym: "Kv4.3-L" RELATED [] synonym: "long isoform" RELATED [] is_a: PR:000000786 ! voltage-gated potassium channel KCND3 [Term] id: PR:000000949 name: voltage-gated potassium channel KCND3 isoform 2 def: "A voltage-gated potassium channel subunit KCND3 that is a translation product of a mature transcript of the KCND3 gene, and that includes the core domains for the voltage-gated potassium channel alpha subunits. This forms lacks the consensus protein kinase C (PKC) phosphorylation site after the last membrane-spanning segment, which is present in Isoform 2. Represented by the sequence UniProtKB:Q9UK17-2." [PMID:9843794] comment: Category=sequence. synonym: "KCND3/iso:2" EXACT PRO-short-label [] synonym: "KCND3S" RELATED [] is_a: PR:000000786 ! voltage-gated potassium channel KCND3 [Term] id: PR:000000950 name: voltage-gated potassium channel KCNG1 isoform 1 def: "A voltage-gated potassium channel KCNG1 that is a translation product of a mature transcript of the KCNG1 gene, and that includes the core domains. Represented by the sequence UniProtKB:Q9UIX4-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNG1/iso:1" EXACT PRO-short-label [] is_a: PR:000000787 ! voltage-gated potassium channel KCNG1 [Term] id: PR:000000951 name: voltage-gated potassium channel KCNG1 isoform 2 def: "A voltage-gated potassium channel KCNG1 that is a translation product of the mature transcript of KCNG1 gene, and lacks the Ion transport protein domain. Represented by the sequence UniProtKB:Q9UIX4-2." [PRO:CNA] comment: Category=sequence. synonym: "KCNG1/iso:2" EXACT PRO-short-label [] is_a: PR:000000787 ! voltage-gated potassium channel KCNG1 [Term] id: PR:000000952 name: voltage-gated potassium channel KCNG3 isoform 1 def: "A voltage-gated potassium channel KCNG3 that is a translation product of a mature transcript of the KCNG3 gene, and arise by the usage of an alternative site of splicing in exon 1 producing an 11-amino acid insertion in the linker between the first and second transmembrane domains. Represented by the sequence UniProtKB:Q8TAE7-1." [PMID:15046870] comment: Category=sequence. synonym: "KCNG3/iso:1" EXACT PRO-short-label [] synonym: "KV10.1b" RELATED [] is_a: PR:000000788 ! voltage-gated potassium channel KCNG3 [Term] id: PR:000000953 name: voltage-gated potassium channel KCNG3 isoform 2 def: "A voltage-gated potassium channel KCNG3 that is a translation product of a mature transcript of the KCNG3 gene, including all core domains. Represented by the sequence UniProtKB:Q8TAE7-2." [PRO:CNA] comment: Category=sequence. synonym: "KCNG3/iso:2" EXACT PRO-short-label [] synonym: "Kv10.1a" RELATED [] is_a: PR:000000788 ! voltage-gated potassium channel KCNG3 [Term] id: PR:000000954 name: voltage-gated potassium channel KCNG4 isoform 1 def: "A Potassium voltage-gated channel subfamily G member 4 that is a translation product of a mature transcript of the KCNG4 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q8TDN1-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNG4/iso:1" EXACT PRO-short-label [] is_a: PR:000000789 ! voltage-gated potassium channel KCNG4 [Term] id: PR:000000955 name: voltage-gated potassium channel KCNH1 isoform 1 def: "A voltage-gated potassium channel KCNH1 that is a translation product of a mature transcript of the KCNH1 gene, and that lacks most of the loop region between segment S3 and S4. Represented by the sequence UniProtKB:O95259-2." [PRO:CNA] comment: Category=sequence. synonym: "KHCN1/iso:1" EXACT PRO-short-label [] synonym: "Eag1" RELATED [] is_a: PR:000000790 ! voltage-gated potassium channel KCNH1 [Term] id: PR:000000956 name: voltage-gated potassium channel KCNH1 isoform 2 def: "A voltage-gated potassium channel KCNH1 that is a translation product of a mature transcript of the KCNH1 gene, with an additional sequence of approximately 27 aminoacids in the region between segments S3 and S4. Represented by the sequence UniProtKB:O95259-1." [PRO:CNA] comment: Category=sequence. synonym: "KHCN1/iso:2" EXACT PRO-short-label [] synonym: "EAGb" RELATED [] is_a: PR:000000790 ! voltage-gated potassium channel KCNH1 [Term] id: PR:000000957 name: voltage-gated potassium channel KCNH2 isoform 1 def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that contains all core domains. Represented by the sequence UniProtKB:Q12809-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNH2/iso:1" EXACT PRO-short-label [] is_a: PR:000000791 ! voltage-gated potassium channel KCNH2 [Term] id: PR:000000958 name: voltage-gated potassium channel KCNH2 isoform 2 def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that lacks most of the cytoplasmic N-terminal domain, including the PAS domain, due to the usage of an alternative exon 1 (1b) that excludes the region coded by exons 2 to 5. Represented by the sequence UniProtKB:O35219-3. This form has rapid deactivation kinetics. Exon nomenclature from PMID:9351462." [PMID:9351446, PMID:9351462] comment: Category=sequence. synonym: "KCNH2/iso:2" EXACT PRO-short-label [] synonym: "ERG1b" EXACT [] is_a: PR:000000791 ! voltage-gated potassium channel KCNH2 [Term] id: PR:000000959 name: voltage-gated potassium channel KCNH2 isoform 3 def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that lacks a C-terminal domain required for expression of rapidly activating delayed rectifier current. This form appears to be partially made up of sequences encoded by regions previously thought to be intronic located between exons 9 and 10. Represented by the sequence UniProtKB:Q12809-3. Exon nomenclature from PMID:9351462." [PMID:9765245] comment: Category=sequence. synonym: "KCNH2/iso:3" EXACT PRO-short-label [] synonym: "ERG USO" RELATED [] is_a: PR:000000791 ! voltage-gated potassium channel KCNH2 [Term] id: PR:000000960 name: voltage-gated potassium channel KCNH2 isoform 4 def: "A voltage-gated potassium channel KCNH2 that is a translation product of a mature transcript of the KCNH2 gene, and that lacks an N-terminal region of approximately 59 residues due to the usage of an alternative exon 1 (exon 1a'). This form lacks most of the PAS domain. Represented by the sequence UniProtKB:O35219-2. This form has rapid deactivation kinetics. Exon nomenclature from PMID:9351462." [PMID:9351462] comment: Category=sequence. synonym: "KCNH2/iso:4" EXACT PRO-short-label [] synonym: "erg1a'" EXACT [] is_a: PR:000000791 ! voltage-gated potassium channel KCNH2 [Term] id: PR:000000961 name: voltage-gated potassium channel KCNH3 isoform 1 def: "A voltage-gated potassium channel KCNH3 that is a translation product of a mature transcript of the KCNH3 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9ULD8-1." [PRO:CNA] comment: Category=sequence. synonym: "KHCN3/iso:1" EXACT PRO-short-label [] is_a: PR:000000792 ! voltage-gated potassium channel KCNH3 [Term] id: PR:000000962 name: voltage-gated potassium channel KCNH4 isoform 1 def: "A voltage-gated potassium channel KCNH4 that is a translation product of a mature transcript of the KCNH4 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q9UQ05-1." [PRO:CNA] comment: Category=sequence. synonym: "KHCN4/iso:1" EXACT PRO-short-label [] is_a: PR:000000793 ! voltage-gated potassium channel KCNH4 [Term] id: PR:000000963 name: voltage-gated potassium channel KCNH5 isoform 1 def: "A voltage-gated potassium channel KCNH5 that is a translation product of a mature transcript of the KCNH5 gene, and that includes all core domains. Represented by the sequence UniProtKB:Q8NCM2-1." [PRO:CNA] comment: Category=sequence. synonym: "KHCN5/iso:1" EXACT PRO-short-label [] is_a: PR:000000794 ! voltage-gated potassium channel KCNH5 [Term] id: PR:000000964 name: voltage-gated potassium channel KCNH5 isoform 2 def: "A voltage-gated potassium channel KCNH5 that is a translation product of a mature transcript of the KCNH5 gene which lacks an exon in the coding region, which results in a frameshift and an early stop codon, as compared to isoform 1. This results in a shorter form that is truncated within the cyclic nucleotide binding domain. The truncated region also includes the calmodulin-binding region. Represented by the sequence UniProtKB:Q8NCM2-2." [PRO:CNA, RefSeq:NP_758963] comment: Category=sequence. synonym: "KHCN5/iso:2" EXACT PRO-short-label [] synonym: "HEAG2b" EXACT [] is_a: PR:000000794 ! voltage-gated potassium channel KCNH5 [Term] id: PR:000000965 name: voltage-gated potassium channel KCNH5 isoform 3 def: "A voltage-gated potassium channel KCNH5 that is a translation product of a mature transcript of the KCNH5 gene that has alternate 5' and 3' ends, as compared to variant 1. It uses a downstream in-frame start codon and an alternate stop codon, resulting in an isoform that has a shorter N-terminus and a distinct C-terminus, as compared to isoform 1. Represented by the sequence UniProtKB:Q8NCM2-3." [PRO:CNA, RefSeq:NP_758964] comment: Category=sequence. synonym: "KHCN5/iso:3" EXACT PRO-short-label [] is_a: PR:000000794 ! voltage-gated potassium channel KCNH5 [Term] id: PR:000000966 name: voltage-gated potassium channel KCNH6 isoform 1 def: "A voltage-gated potassium channel KCNH6 that is a translation product of a mature transcript of the KCNH6 gene, and that contains the core domains. Represented by the sequence UniProtKB:Q9H252-1." [PRO:CNA] comment: Category=sequence. synonym: "KHCN6/iso:1" EXACT PRO-short-label [] is_a: PR:000000795 ! voltage-gated potassium channel KCNH6 [Term] id: PR:000000967 name: voltage-gated potassium channel KCNH6 isoform 2 def: "A voltage-gated potassium channel KCNH6 that is a translation product of a mature transcript of the KCNH6 gene that lacks two in-frame segments in the coding region, rendering a protein shorter than isoform 1. It lacks the loop region connecting segments S5 and S6, and a region consisting of around 38 residues following the cytoplasmic cyclic nucleotide binding domain. Represented by the sequence UniProtKB:Q9H252-2." [PRO:CNA] comment: Category=sequence. synonym: "KHCN6/iso:2" EXACT PRO-short-label [] is_a: PR:000000795 ! voltage-gated potassium channel KCNH6 [Term] id: PR:000000968 name: voltage-gated potassium channel KCNH6 isoform 3 def: "A voltage-gated potassium channel KCNH6 that is a translation product of a mature transcript of the KCNH6 gene, that lacks the region coding for the C-terminus of the protein including part of the segment S6 and the cyclic nucleotide-binding domain, rendering a truncated protein compared to isoform 1. Represented by the sequence UniProtKB:Q9H252-3." [PRO:CNA] comment: Category=sequence. synonym: "KHCN6/iso:3" EXACT PRO-short-label [] is_a: PR:000000795 ! voltage-gated potassium channel KCNH6 [Term] id: PR:000000969 name: voltage-gated potassium channel KCNS1 isoform 1 def: "A voltage-gated potassium channel KCNS1 that is a translation product of a mature transcript of the KCNS1 gene, and that includes the core domains. Represented by the sequence UniProtKB:Q96KK3-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNS1/iso:1" EXACT PRO-short-label [] is_a: PR:000000798 ! voltage-gated potassium channel KCNS1 [Term] id: PR:000000970 name: voltage-gated potassium channel KCNS2 isoform 1 def: "A voltage-gated potassium channel KCNS2 that is a translation product of a mature transcript of the KCNS2 gene, and that includes the core domains. Represented by the sequence UniProtKB:O35174-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNS2/iso:1" EXACT PRO-short-label [] is_a: PR:000000799 ! voltage-gated potassium channel KCNS2 [Term] id: PR:000000971 name: voltage-gated potassium channel subunit KCNA10 isoform 1 def: "A voltage-gated potassium channel subunit KCNA10 that is a translation product of a mature transcript of the KCNA10 gene, and that includes the potassium channel alpha subunit core domains. Represented by the sequence UniProtKB:Q16322-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNA10/iso:1" EXACT PRO-short-label [] is_a: PR:000000809 ! voltage-gated potassium channel subunit KCNA10 [Term] id: PR:000000972 name: voltage-gated potassium channel subunit KCNA2 isoform 1 def: "A voltage-gated potassium channel subunit KCNA2 that is a translation product of a mature transcript of the KCNA2 gene, and that includes the potassium channel alpha subunit core domains. Represented by the human UniProtKB:P16389-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNA2/iso:1" EXACT PRO-short-label [] is_a: PR:000000810 ! voltage-gated potassium channel subunit KCNA2 [Term] id: PR:000000973 name: voltage-gated potassium channel subunit KCNA3 isoform 1 def: "A voltage-gated potassium channel subunit KCNA3 that is a translation product of a mature transcript of the KCNA3 gene, and that includes the potassium channel alpha subunit core domains. Represented by the sequence UniProtKB:P22001-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNA3/iso:1" EXACT PRO-short-label [] is_a: PR:000000811 ! voltage-gated potassium channel subunit KCNA3 [Term] id: PR:000000974 name: voltage-gated potassium channel subunit KCNA5 isoform 1 def: "A voltage-gated potassium channel subunit KCNA5 that is a translation product of a mature transcript of the KCNA5 gene, and that includes the potassium channel alpha subunit core domains. Represented by the sequence UniProtKB:P22460-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNA5/iso:1" EXACT PRO-short-label [] is_a: PR:000000812 ! voltage-gated potassium channel subunit KCNA5 [Term] id: PR:000000975 name: voltage-gated potassium channel subunit KCNA5 isoform 2 def: "A voltage-gated potassium channel subunit KCNA5 that is a translation product of a mature transcript of the KCNA5 gene, and that lacks the N terminus tetramerization domain. Represented by the sequence UniProtKB:Q61762-2." [PMID:11524461, PMID:8226976] comment: Category=sequence. synonym: "KCNA5/iso:2" EXACT PRO-short-label [] synonym: "Kv1-5delta5'" RELATED [] synonym: "voltage-gated potassium channel subfamily A member 5 isoform 2" RELATED [] is_a: PR:000000812 ! voltage-gated potassium channel subunit KCNA5 [Term] id: PR:000000976 name: voltage-gated potassium channel subunit KCNA5 isoform 3 def: "A voltage-gated potassium channel subunit KCNA5 that is a translation product of a mature transcript of the KCNA5 gene, and that lacks the C terminus intracellular part. Represented by the sequence UniProtKB:Q61762-3." [PMID:8226976] comment: Category=sequence. synonym: "KCNA5/iso:3" EXACT PRO-short-label [] synonym: "Kv1-5delta3'" RELATED [] synonym: "voltage-gated potassium channel subfamily A member 5 isoform 3" RELATED [] is_a: PR:000000812 ! voltage-gated potassium channel subunit KCNA5 [Term] id: PR:000000977 name: voltage-gated potassium channel subunit KCNA5 sequence variant 1 def: "A voltage-gated potassium channel subunit Kv1.5 that has a C-terminal truncation and lacks the S4-S6 voltage sensor, pore region and C terminus, but preserves the N terminus and S1-S3 transmembrane domains that secure tetrameric subunit assembly. Example: UniProtKB:P22460-1 (1-374)." [PMID:16772329] comment: Category=sequence. is_a: PR:000000812 ! voltage-gated potassium channel subunit KCNA5 [Term] id: PR:000000978 name: voltage-gated potassium channel subunit KCNA6 isoform 1 def: "A voltage-gated potassium channel subunit KCNA6 that is a translation product of a mature transcript of the KCNA6 gene, and that includes the potassium channel alpha subunit core domains. Represented by the sequence UniProtKB:P17658-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNA6/iso:1" EXACT PRO-short-label [] is_a: PR:000000813 ! voltage-gated potassium channel subunit KCNA6 [Term] id: PR:000000979 name: voltage-gated potassium channel subunit KCNA7 isoform 1 def: "A voltage-gated potassium channel subunit KCNA7 that is a translation product of a mature transcript of the KCNA7 gene, and that includes the potassium channel alpha subunit core domains plus an additional N terminal sequence with a Hx20CxCC motif resembling a metal coordination motif. This N terminus appears to be a key component in the redox sensitivity of Kv1.7 channel inactivation. This form contributes to channels that inactivate fast and are sensitive to redox modulation. Represented by the sequence UniProtKB:Q17ST2-1." [PRO:CNA] comment: Category=sequence. synonym: "KCNA7/iso:1" EXACT PRO-short-label [] synonym: "Kv1.7L" RELATED [] synonym: "Potassium voltage-gated channel subfamily A member 7 isoform 1" RELATED [] is_a: PR:000000814 ! voltage-gated potassium channel subunit KCNA7 [Term] id: PR:000000980 name: voltage-gated potassium channel subunit KCNA7 isoform 2 def: "A voltage-gated potassium channel subunit KCNA7 that is a translation product of a mature transcript of the KCNA7 gene, and that includes the potassium channel alpha subunit core domains. Represented by the sequence UniProtKB:Q17ST2-2. This form contributes to channels that are slow-inactivating and redox-insensitive." [PRO:CNA] comment: Category=sequence. synonym: "KCNA7/iso:2" EXACT PRO-short-label [] synonym: "Kv1.7S" RELATED [] is_a: PR:000000814 ! voltage-gated potassium channel subunit KCNA7 [Term] id: PR:000000981 name: cGMP-gated cation channel alpha-1 isoform 1 phosphorylated 1 def: "A cGMP-gated cation channel alpha-1 isoform 1 phosphorylated form that has been phosphorylated at a Tyr residue within VYSPGD motif located at the N-terminus of the cyclic-nucleotide binding domain (CNDB). This phosphorylation prevents Ca2+/CaM inhibition of the CNG channel, but at the same time has a similar effect, that is decreases the apparent affinity for cGMP." [PMID:10366613, PMID:14602825] comment: Category=modification. is_a: PR:000000932 ! cGMP-gated cation channel alpha-1 isoform 1 phosphorylated form [Term] id: PR:000000982 name: platelet-derived growth factor C isoform 1 cleaved 1 def: "A platelet-derived growth factor C isoform 1, signal peptide removed form that has been processed by subsequent removal of the CUB domain." [PRO:CNA] comment: Category=modification. is_a: PR:000018298 ! platelet-derived growth factor C proteolytic cleavage product relationship: derives_from PR:000021917 ! platelet-derived growth factor C isoform 1, signal peptide removed form [Term] id: PR:000000983 name: platelet-derived growth factor C isoform 1 sumoylated 1 def: "A platelet-derived growth factor C isoform 1 sumoylated form sumoylated by SUMO1." [PMID:16443219] comment: Category=modification. is_a: PR:000000934 ! platelet-derived growth factor C isoform 1 sumoylated form [Term] id: PR:000000984 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated form with glycosylation at the N-linked glycosylation consensus sequence (Nx[ST]) in the extracellular domain between S5 and S6 transmembrane segments." [PMID:17988239] comment: Category=modification. is_a: PR:000000935 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 isoform 1 glycosylated form [Term] id: PR:000000985 name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated 1 def: "A potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated form with glycosylation at the N-linked glycosylation consensus sequence (Nx[ST]) in the extracellular domain between S5 and S6 transmembrane segments. Example: UniProtKB:O88703-1, has_part MOD:00160 N4-glycosyl-L-asparagine, Asn-380." [PMID:12928435] comment: Category=modification. is_a: PR:000000936 ! potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 isoform 1 glycosylated form [Term] id: PR:000000986 name: voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form def: "A voltage-gated potassium channel KCNC1 isoform 2 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000940 ! voltage-gated potassium channel KCNC1 isoform 2 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000987 name: voltage-gated potassium channel KCNC4 isoform 2 phosphorylated form def: "A voltage-gated potassium channel KCNC4 isoform 2 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000946 ! voltage-gated potassium channel KCNC4 isoform 2 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000988 name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated form def: "A voltage-gated potassium channel KCND2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000947 ! voltage-gated potassium channel KCND2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000989 name: voltage-gated potassium channel KCNH2 isoform 1 glycosylated form def: "A voltage-gated potassium channel KCNH2 isoform 1 that has been post-translationally modified to include at least one glycosylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000957 ! voltage-gated potassium channel KCNH2 isoform 1 intersection_of: has_part MOD:00693 ! glycosylated residue [Term] id: PR:000000990 name: voltage-gated potassium channel KCNH2 isoform 1 phosphorylated form def: "A voltage-gated potassium channel KCNH2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000957 ! voltage-gated potassium channel KCNH2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000991 name: voltage-gated potassium channel subunit KCNA2 isoform 1 phosphorylated form def: "A voltage-gated potassium channel subunit KCNA2 isoform 1 that has been post-translationally modified to include at least one phosphorylated residue." [PRO:CNA] comment: Category=modification. intersection_of: PR:000000972 ! voltage-gated potassium channel subunit KCNA2 isoform 1 intersection_of: has_part MOD:00696 ! phosphorylated residue [Term] id: PR:000000992 name: voltage-gated potassium channel KCNC1 isoform 2 phosphorylated 1 def: "A voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form that has been phosphorylated by PKC at a Ser residue within the DSKL motif located in the C-terminal tail. In resting neurons, basal phosphorylation at this site decreases Kv3.1 channel current, reducing neuronal ability to follow high frequency stimulation. Example: UniProtKB:P25122-1, has_part MOD:00046 O-phospho-L-serine, Ser-502." [PMID:16595659] comment: Category=modification. is_a: PR:000000986 ! voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form [Term] id: PR:000000993 name: voltage-gated potassium channel KCNC4 isoform 2 phosphorylated 1 def: "A voltage-gated potassium channel KCNC1 isoform 2 phosphorylated form that has been phosphorylated by PKC at multiple Ser residues located in the N-terminal domain. Example: Q03721-2, has_part MOD:00046 O-phospho-L-serine, Ser-8/Ser-9/Ser-15/Ser-21." [PRO:CNA] comment: Category=modification. is_a: PR:000000987 ! voltage-gated potassium channel KCNC4 isoform 2 phosphorylated form [Term] id: PR:000000994 name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated 1 def: "A voltage-gated potassium channel KCND2 isoform 1 phosphorylated form phosphorylated in the amino and carboxyl terminal cytoplasmic domains by cAMP-dependent protein kinase (PKA). At the N-terminus, the phosporylation occurs at a Thr residue within the PKA consensus phosphorylation sequence adjacent to the first transmembrane domain (segment S1). At the C-terminus, it occurs at the conserved Ser within the motif [RQ]GS[IV]QEL. Example:UniProtKB:Q9Z0V1-1, has_part MOD:00047 O-phospho-L-threonine, Thr-38, has_part MOD:00046 O-phospho-L-serine, Ser-552." [PMID:10681507] comment: Category=modification. is_a: PR:000000988 ! voltage-gated potassium channel KCND2 isoform 1 phosphorylated form [Term] id: PR:000000995 name: voltage-gated potassium channel KCND2 isoform 1 phosphorylated 2 def: "A voltage-gated potassium channel KCND2 isoform 1 phosphorylated form phosphorylated in the amino terminal cytoplasmic domain by cAMP-dependent protein kinase (PKA). The phosporylation occurs at a Thr residue within the PKA consensus phosphorylation sequence adjacent to the first transmembrane domain (segment S1). Example:UniProtKB:Q9Z0V1-1, has_part MOD:00047 O-phospho-L-threonine, Thr-38." [PMID:11040264] comment: Category=modification. is_a: PR:00